3K65


Conserved Protein Domain Family
Thrombin_light

?
pfam09396: Thrombin_light 
Thrombin light chain
Thrombin is an enzyme that cleaves bonds after Arg and Lys, converts fibrinogen to fibrin and activates factors V, VII, VIII. Prothrombin is activated on the surface of a phospholipid membrane where factor Xa removes the activation peptide and cleaves the remaining part into light and heavy chains. This domain corresponds to the light chain of thrombin.
Statistics
?
PSSM-Id: 401374
View PSSM: pfam09396
Aligned: 24 rows
Threshold Bit Score: 71.9537
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3K65_B         3 TSEYQTFFNPRTFGSGEADCGLRPLFEKKSLEDKTERELLESYIDGR 49 
XP_015194117 277 aGSYKTFFNPNSFGQGEADCGIRPMFERVNKQDATEKELTESYIASR 323 spotted gar
XP_007244969 312 TEKRTAFFSPRSFGQGEEECGVRPLFEKVSKADGTEVELLKSY---S 355 Mexican tetra
XP_005169022 327 LDQRKAFFNPRSFGNGELDCGERPLFEKINKADKNEKELLMSYTGSR 373 zebrafish
CAF95775     290 LSSRKQFFNPRTFGQGENDCGQRPLFEKISKKDAKEDELLESYREKR 336 spotted green pufferfish
NP_001027864 311 SSSKKRFFNPRTFGEGEDECGRRPLFEQKNKKDASEDELLQSYREKR 357 torafugu
XP_005812182 310 gpEKKLFFSPRSFGQGESVCGQRPLFEQKGKQDKNENELLESYREQR 356 southern platyfish
2_pfamImport   1 --ARKTFFSPRTFGEGESVCGERPLFEKLKKKDRNEAELLESYRQER 45 
XP_023818208 310 apAKKLFFNPRTFGEGESSCGLRPLFELKSKKDAKEQELLDSYREQR 356 Japanese medaka
XP_031601670 312 gQARKNLFSPRTFGQGEDDCGQRPLFEKISKTDQKEAELLESYAGAR 358 Oreochromis aureus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap