2GIA


Conserved Protein Domain Family
MRP

?
pfam09387: MRP 
Mitochondrial RNA binding protein MRP
MRP1 and MRP2 are mitochondrial RNA binding proteins that form a heteromeric complex. The MRP1/MRP2 heterotetrameric complex binds to guide RNAs and stabilizes them in an unfolded conformation suitable for RNA-RNA hybridisation. Each MRP subunit adopts a 'whirly' transcription factor fold.
Statistics
?
PSSM-Id: 401368
View PSSM: pfam09387
Aligned: 9 rows
Threshold Bit Score: 180.519
Threshold Setting Gi: 1387243481
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2GIA_A         4 SSSdADGKEVGSsgegnratggkwrrpSLAQQRARR----AQLPPAFDVVHWNDEDISRG-------------------- 59 
2_pfamImport   1 FTA-GDGPDTEGhayarnt--asvkdrASRTVKQHR----STSKPAFNINHMSRKATSSAvsqsschslqgnmalrppvl 73 
XP_005621272  62 ACAtEDGQARDThscasst--aslkdrAARTVKQRR----SASKPAFSINHTSRKVVSCGvgqsgtstlssaaclrppvl 135 dog
XP_003721918  18 SVRfQSSSALPAmnqnr-------------rsqnRRnfisTNSLPKFEI-HDVRDDPEHG-------------------- 63  Leishmania majo...
Q4QHR3        47 SSDaVaptsnnaq-------rnnsrnsSMQSQRGRR----DAMPPAFDIVHWNDEDIAAG-------------------- 95  Leishmania major
XP_829385     33 SSSdADGKEVGSsgegnratggkwrrpSLAQQRARR----AQLPPAFDVVHWNDEDISRG-------------------- 88  Trypanosoma bru...
Q4DWJ0        36 SEApADSNAKHDtntsgsa--srwrrlSASQLRARR----PQLPPAFDVVHWNDDDMSSG-------------------- 89  Trypanosoma cruzi
XP_024840927  62 ARAaGDGPAGDG---------------AARLTKQRS----SAHRSAFSIHHSSRKVLSSAvshggsgtvqasaclrppvl 122 cattle
XP_023510831  62 ACAtEEGQAGDApscpssa--aslrdrAARTAKQRR----SASKLAFSVNHASGKAVSLAvgrrgsgglqgaaclqppvl 135 horse
2GIA_A        60 --HLLR-VLHRDTFVVLDyhrqa---rmltEEG--------------NKAERVvs--vMLPAVYTARFLAVLEGR---SE 114
2_pfamImport  74 deSLIReQTKVDHFWGLD------------DDSdlkeplggskaalqGNGDLAtvadtATVNGYTCSNCSLLSERkdvLT 141
XP_005621272 136 deSLIReQTKVDHFWGLD------------DDGdlkggn---kaatqGNGDLAae--aARSNGYTCSDCLLLSERkdtLT 198 dog
XP_003721918  64 --SMTR--VSVDGKQLLvsq--------fpQLGprkadp--ndttpqFDRDRRis--mRFRHIDLAGFVSVVENR---IS 124 Leishmania majo...
Q4QHR3        96 --HLLR-VVHRDGFIVLDyhrqrcataelrEDGsra--------anpNRAERVvt--vTLPPVYVARFLGVLEGR---MS 159 Leishmania major
XP_829385     89 --HLLR-VLHRDTFVVLDyhrqa---rmltEEG--------------NKAERVvs--vMLPAVYTARFLAVLEGR---SE 143 Trypanosoma bru...
Q4DWJ0        90 --HLLR-VLHRDSFVVLDyhrqv---kklgEEG--------------NKAERVvs--vMLPAVYTARFLGVLEGR---LD 144 Trypanosoma cruzi
XP_024840927 123 deSLIReQTKVDHFWGLD------------DDGdlkggn---kaaiqGNGEVAae--aAGSNGYMCSECSLLAERkgaLT 185 cattle
XP_023510831 136 deSLIReQTKVDHFWGLD------------DDGdlkggs---eaavqGNGDLA-----ARSNGFTCRDCSLLSGRedaLT 195 horse
2GIA_A       115 KVEVHSRYTNATFTPNPAAPytftlkctst-------------------------------------------------- 144
2_pfamImport 142 AHPTARGPTSRVYSRDRSQKr----------------------------------------------------------- 162
XP_005621272 199 AHSATHGPSPRLYSRDQGQKrndskgkellemhrairqqssspkrvagaiwhifs------------------------- 253 dog
XP_003721918 125 SHHVKNNAFDMAFEKTTngyvlkg-------------------------------------------------------- 148 Leishmania majo...
Q4QHR3       160 KLEVQSRFTNASFSPNAAKGkhhytlrctsmk------------------------------------------------ 191 Leishmania major
XP_829385    144 KVEVHSRYTNATFTPNPAAPytftlkctstr------------------------------------------------- 174 Trypanosoma bru...
Q4DWJ0       145 KVEVQSRFTNAVFAPDPAVPhtfilnctstr------------------------------------------------- 175 Trypanosoma cruzi
XP_024840927 186 ACSAAHGPVSRIYSRDRHQKrraagcgdgiwslavrtsascasflvqlfqvvlmklnyasenyklkscesksyeseshes 265 cattle
XP_023510831 196 TLPVAHGTSSRVYSRDRTQKrgasfcvdriwwlakytsssfssflvqlfqvvlmklnyesenyklksyeskdresesyks 275 horse
2GIA_A           --------------------------------------------------------------------------------    
2_pfamImport     --------------------------------------------------------------------------------    
XP_005621272 254 -------------------------------------------------------------ytghllvqmlqrigasgws 272 dog
XP_003721918     --------------------------------------------------------------------------------     Leishmania majo...
Q4QHR3           --------------------------------------------------------------------------------     Leishmania major
XP_829385        --------------------------------------------------------------------------------     Trypanosoma bru...
Q4DWJ0           --------------------------------------------------------------------------------     Trypanosoma cruzi
XP_024840927 266 kahsshcgrmdasmrlaedghlrangaslcdeckgrkhlethvstrsrpgglagtlglalsragqlsgqalhragaagwr 345 cattle
XP_023510831 276 ksre-----------------------------stahssycgrvnvtelfredgrlgvhgeslcrllmqtlrrigaagwf 326 horse
2GIA_A       145 ------rpaqqkqqvaGEEGDETFEWT----VEFDVAESLMLQRFLTQALHYNTG 189
2_pfamImport 163 ----------------RKAASGVFWWLgfgwYQFVTLMSWLNVFLLTRCLRNICK 201
XP_005621272 273 vsktllcvlwlamvapGKAASGIFWWLgigwYQFVTLISWLNVFLLTRCLRNICK 327 dog
XP_003721918 149 -------------qvhrsnsQANEEWA----VRFENQFAVTMEHFLESALTESFG 186 Leishmania major strain Friedlin
Q4QHR3       192 -----pttgqiqtvdgADVHEETVEWT----VEFDAAESLMLHRFLTQALHYNTG 237 Leishmania major
XP_829385    175 -------paqqkqqvagEEGDETFEWT----VEFDVAESLMLQRFLTQALHYNTG 218 Trypanosoma brucei brucei TREU927
Q4DWJ0       176 ------ppqqqqqqnggNGEEEKFDWT----VKFDVAESLMLHRFLTQALHYNTG 220 Trypanosoma cruzi
XP_024840927 346 vsrtllsvlclataapGKAASEVFWWLgigwYQFVTLISWLNVFLLTRCLRNICK 400 cattle
XP_023510831 327 vlkavlsvvwlavvapGKAASGVLWWLgigwYQLVTLISWLNVFLLTRCLRNICK 381 horse
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap