4PY2


Conserved Protein Domain Family
tRNA-synt_1g

?
pfam09334: tRNA-synt_1g 
Click on image for an interactive view with Cn3D
tRNA synthetases class I (M)
This family includes methionyl tRNA synthetases.
Statistics
?
PSSM-Id: 401322
View PSSM: pfam09334
Aligned: 23 rows
Threshold Bit Score: 478.323
Threshold Setting Gi: 25009406
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4PY2_B  27 YYITTAIAYPNGKPHIGHAYELIATDAMARFQRLNGMDVYFLTGTDEHGIKMLQSARKEGITPRDLADRNTSAFRRMAEV 106 Brucella abortus 2308
Q9HSA4  12 AVVTCGLPYPTGDLHIGHLRTYVSGDAFSRALRKLGQETVFVSGTDMHGTPIAVQAIEAGVGPLDLGLERHEQYADTFEE 91  Halobacterium salinar...
Q8TIU5  13 VLVTCGLPYANGKAHIGHLRTYVPADIFARSLRKEGREVTFVCGSDTHGTPIVVNAEELGITPKELVEIYHKHFDETFKQ 92  Methanosarcina acetiv...
Q90YI3  44 YYITTPIFYVNASPHLGHLYSAVIADCFHRHKQLQGFNSRFATGTDEHGLKIQQAAEAAGKEPLEFCTTVSERFRHLFSS 123 torafugu
Q9PQU6   7 FFISTPIYYSSGNPHIGHAYTTIIADVLARYKRLFGYDVFFLTGMDEHGQKIQQKAFEENISPKALVDRNSIIFLNLWKR 86  Ureaplasma parvum ser...
Q5L3W2   6 FYLTTPIYYPSDRLHIGHAYTTVAGDAMARYKRMRGYDVMYLTGTDEHGQKIQRKAEEKGVTPQQYVDEIVAGIQELWKK 85  Geobacillus kaustophilus
Q8EZD6  10 ILVTSALPYANGPIHLGHVLEGIQTDIWVRFQKAIGNECYFFCADDTHGTPVMLAARKEGITPEQLIERVGQEHYRDLTS 89  Leptospira interrogan...
Q8PAY7   5 ALVTTALPYANGPLHLGHLVGYIQADIWVRARRLRGDKTWFVCADDTHGTPIMLAAEKAGVTPEAFIANIQASHERDFAA 84  Xanthomonas campestri...
P43828   8 ILVTCALPYANGAIHLGHMLEHIQADIWVRFQRMRGNKIHFVCADDAHGTPIMLNADKLGITPEELIAKAKADHIRDFAG 87  Haemophilus influenza...
P57210   8 ILVTCALPYANGSIHIGHMLEHIQADIWVRYHRMRGHEVWFVSADDAHGTAIMLKAQDLEISPNKLIKNIRIEHQIDFSN 87  Buchnera aphidicola s...
4PY2_B 107 LNSSNDDYIRTSEERHYKASQAIWQAMVANGDIYKGGYAGWYSVRDEAYYGEEE-T-----EV--------RADGVRY-G 171 Brucella abortus 2308
Q9HSA4  92 FSVAFDTYGHTDEETNVELTREFVGAWEDNDHVYETEIQVAYDPDADQWLPDRY-V-----EGtcpy-cgeHARGDECdE 164 Halobacterium salinar...
Q8TIU5  93 LGVYFDAFGTTDDPENHNRTLDIVNRLIEKDYVYPKIIEIAYCPACNRFLPDRY-V-----EGacph-cgeTARGDECdQ 165 Methanosarcina acetiv...
Q90YI3 124 CNISNTDYIRTTEQRHHRAVQHFWSVLCSKGLIYKGSYEGWYSTQDESFLTPSQvtta----------ldsTGKEIKVsL 193 torafugu
Q9PQU6  87 LNISFSKFIRTTQMDHEESVQKVFSYLYKQGKIYLGQWTGYYCVSCEENYNPAEiiksqdniMl---------------c 151 Ureaplasma parvum ser...
Q5L3W2  86 LDISYDDFIRTTQERHKKVVEQIFTRLVEQGDIYLGEYEGWYCTPCESFYTERQlV-----DGnc--------------p 146 Geobacillus kaustophilus
Q8EZD6  90 FGIEYDHYDSTHSKANQEISKDIYLKLKSKGHISRRSIEQSYCETDKMFLPDRF-I-----KGtcpnckskDQYGDNC-E 162 Leptospira interrogan...
Q8PAY7  85 FGVTFDHYDSTNSPVNRELTEAFYTKLEAAGHISRRSVAQFYDPAKGMFLPDRY-I-----KGicpncgsaDQYGDNC-E 157 Xanthomonas campestri...
P43828  88 FNISFDNYHSTHSEENKQLTAEIYNKLKANGFIKSKVISQLFDPEKNMFLPDRF-V-----KGtcpkckaeDQYGDNC-E 160 Haemophilus influenza...
P57210  88 FKISHDNYYSTHSLENLYLSRKIFTCLNEKGLIKEKKIFQLYDTVKKIFLPDRF-I-----KGtcpickskNQYGDNC-E 160 Buchnera aphidicola s...
4PY2_B 172 PQGTPVE----------------WVE-EESYFFRLSAYQDK--------------------LLDLY-ENNPGfimPAERR 213 Brucella abortus 2308
Q9HSA4 165 GCQRHLEpgeieapvstitgnsaEYHeRAHKFLRLSDFQEY--------------------LEGFInRME-----GTNNA 219 Halobacterium salinar...
Q8TIU5 166 GCGKHLEpgelqnpvcticggpaEYRhQEHFFFKLSEFGDY--------------------LMDYL-SNDLG---GTTNA 221 Methanosarcina acetiv...
Q90YI3 194 ESGHKVE----------------WMK-EENYMFRLSGFRSQ--------------------LLDWL-RENPRa-iQPERF 234 torafugu
Q9PQU6 152 RMGHKLE----------------TKS-EESYFYKMSDQAPF--------------------LKTYY-QNHPNfiiPNERA 193 Ureaplasma parvum ser...
Q5L3W2 147 DCGRPVE----------------KVK-EESYFFRMSKYVDR--------------------LLQYY-EENPDfiqPESRK 188 Geobacillus kaustophilus
Q8EZD6 163 VCGATYSpkdlidshcslcgtspVVKnSDHIFFKLGDFHKKdekstsletinpshlktdfdLQSWIeTSGVVs--ESEGV 240 Leptospira interrogan...
Q8PAY7 158 VCGATYAptelkepksvisgatpELRdSEHFFFEVGHFDGF--------------------LREWLdGDV-----ALPGV 212 Xanthomonas campestri...
P43828 161 VCASTYSpmdlinprsavsgttpIVKeSEHFFFDLPAFEGM--------------------LKEWTrSGS-----LQSEI 215 Haemophilus influenza...
P57210 161 ICSATYEptdlinpisvisgkkpILKnTKHLYFDLPSFTNM--------------------LKKWIhSGV-----LEESV 215 Buchnera aphidicola s...
4PY2_B 214 NEIV-SFV--KSGLKDLSISr--TTFDW-GIPVP--GDEKHVMYVWVDALTNYITALGYPD----TTDE-RWA-YWpaN- 278 Brucella abortus 2308
Q9HSA4 220 KNQPrEWI--EGGLEDFCIT---RDLDW-GIDYPgeGGDDLVLYVWVDAPIEYVAATKQYSer-vGTEEfDWAsVW--Kd 290 Halobacterium salinar...
Q8TIU5 222 RNYAlGWV--KQGLTDWCIT---RNLEW-GVRFP--GHEDLVVYVWVDAPIGYIAFTEEWAa---QAGD-SWEkFWkge- 288 Methanosarcina acetiv...
Q90YI3 235 HHSVlQWL--QEELPDLSVSrqkSRLQW-GIPVP--EDDGQTIYVWLDALVNYLTVVGY--------PN-NHErWWnvA- 299 torafugu
Q9PQU6 194 NEMVnNFL--NN-LEDLSISr--TTFDW-GIPIA--ENPKHVIYVWLDALMNYLTATGYLS----NNEE-LFQkYWcdNe 260 Ureaplasma parvum ser...
Q5L3W2 189 NEMInNFI--KPGLEDLAVSr--TTFDW-GIKVP--GNPKHVIYVWIDALANYITALGYGT----DNDE-KFRkYWpaD- 255 Geobacillus kaustophilus
Q8EZD6 241 KKKLkEWF--DAGLQDWDIS---RDGPYfGFEIP--DETNKYFYVWLDAPIGYMASSKNFFeknfPNEPnKFDsFW--Kn 311 Leptospira interrogan...
Q8PAY7 213 KAKLkEWLdaEGGLRAWDIS---RDAPYfGFQIP--GQPGKYFYVWLDAPIGYLCSFKTLCaq---mgE-DFQaHLa-Ag 282 Xanthomonas campestri...
P43828 216 ANKMqEWF--ESDLQQWDIS---RDAPYfGFEIP--GAKDKFFYVWLDAPIGYMASFKNLCnre----giDFNeFWa-Eg 283 Haemophilus influenza...
P57210 216 IKKTeEWF--KVGLKSWAIS---RDAPYfGFKIP--NYPNKYFYVWLDAPIGYISAFKNLCfk---skKlNFNeLWn-Qn 284 Buchnera aphidicola s...
4PY2_B 279 -----AHIIGKDISRFHAVYWPAFLMSAQLPLPKRVFAHGFLFNRGEKMSKSVGNVIDP-FELVER-YGLDQLRYFLMR- 350 Brucella abortus 2308
Q9HSA4 291 gdgeiIHVIGRDIIQHHTVFWPSMLAGADYAEPRAVCATGFVNIDGRGLSTSKNRAIWA-AEYLDAgFHPDLLRYYLAT- 368 Halobacterium salinar...
Q8TIU5 289 --geiVHFIGGDITYHHCIFWPAMLNGADYSVPTAVVASGMVKIEDKKFSKTRGYVVWVgEDYLDHgFHPDLLRYYLAS- 365 Methanosarcina acetiv...
Q90YI3 300 -----HHIIGKDILKFHAIYWPSFLLGAGLPLPQTIHVHSHWTVAGKKMSKSLGNVIDP-QERSQL-FTTDGLRYFLLR- 371 torafugu
Q9PQU6 261 t--eiVHLLSKEIARFHCIYWPIFLNDLQIRFPSTILSHGWIITKEGKMSKSLGNVIDP-NVLIDT-YGVDALRYYLMA- 335 Ureaplasma parvum ser...
Q5L3W2 256 -----VHLVGKEIVRFHTIYWPIILMALGLPLPKKVFGHGWLLMKDGKMSKSKGNVVDP-VTLIDR-YGLDALRYYLLR- 327 Geobacillus kaustophilus
Q8EZD6 312 knseiVHFIGKDILYFHTLFWPAMLEGSDYRAPSKVHVHGFIGVNGEKMSKSRGTFIKA-ETFVKY-LDPEHLRFYLASk 389 Leptospira interrogan...
Q8PAY7 283 tqtelHHFIGKDIVNFHGLFWPAVLHGTGHRAPTRLHVNGYLMVDGAKMSKSRGTFVMA-RTFLDVgLEPEALRYYFAAk 361 Xanthomonas campestri...
P43828 284 sdaelYHFIGKDIVYFHSLFWPAMLEGSGYRKPTNVFAHGYVTVDGAKMSKSRGTFIQA-STYLNH-IDPECLRYYYAAk 361 Haemophilus influenza...
P57210 285 snyelYHFIGKDIIYFHTLFWPAILEAVSFRQPSGIFVHGHLTMNGLKLSKSRGALIKA-SDWIQY-FDSDSLRYYYASk 362 Buchnera aphidicola s...
4PY2_B 351 EVPFGQDGSYSHEAIVNRTNADLANDLGNLAQRS 384 Brucella abortus 2308
Q9HSA4 369 ASGFERDVNFSWAEFAQRVNTELADAVGNFAYRA 402 Halobacterium salinarum NRC-1
Q8TIU5 366 YTSHTKELNFSWRVLQEKINAELVAVLGNFLYRT 399 Methanosarcina acetivorans C2A
Q90YI3 372 QGVPDTDCDYRDDKVVKLLNAELADALGGLLNRC 405 torafugu
Q9PQU6 336 DLSLFRDAIFSEDNLIETYNTQLANSYGNMISRT 369 Ureaplasma parvum serovar 3 str. ATCC 700970
Q5L3W2 328 EVPFGADGVFTPEGFIERINYDLANDLGNLLHRT 361 Geobacillus kaustophilus
Q8EZD6 390 LGPGMDDIDLSFEDFINKVNSDLVGNLINSVSRV 423 Leptospira interrogans serovar Lai str. 56601
Q8PAY7 362 SSGGVDDLDLNLGDFVARVNADLVGKFVNLASRC 395 Xanthomonas campestris pv. campestris str. ATCC 33913
P43828 362 LNDRIEDLDFNLEDFVQRVNTDIVNKLVNLASRN 395 Haemophilus influenzae Rd KW20
P57210 363 LSNKTHDIEINLEDFIQKINSDIVNKLVNLAARN 396 Buchnera aphidicola str. APS (Acyrthosiphon pisum)
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap