Conserved Protein Domain Family
Mcm10

?
pfam09332: Mcm10 
Mcm10 replication factor
Mcm10 is a eukaryotic DNA replication factor that regulates the stability and chromatin association of DNA polymerase alpha.
Statistics
?
PSSM-Id: 401320
View PSSM: pfam09332
Aligned: 19 rows
Threshold Bit Score: 329.767
Threshold Setting Gi: 308258512
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q28E45       506 GALNLKKHFSGVPTQ---ANEKG--GQPFQSISASALLKQQKQqm---lGARKKRAEEIQKRFLESTEKSEKSS------ 571 tropical clawed...
XP_022526968 517 GALNIKRHLGKSKPT---DSS----GSTVQSISASDLLKQQKQmhkqrlEARQKRAEEIQKRVMQKTRGAAVPA------ 583 Mexican tetra
Q5RHY1       489 GALNIKRHLGQSKSS---AVA----GSSVQSVSASDLLKQQKEqhqqrmMARKKRAEEIQKRVLQSGGAPVASS------ 555 zebrafish
Q9U2C2       370 G----LKKITKEEEK---SSLNDllSQRKNTFAARQMLKLKEKkde-klAESVEEMIEFLGTTGGEEKPSVHSSfgefla 441 Caenorhabditis ...
EFP02465     374 T----LKQITKEEEK---SSLNDilNQRKNTFAARQILKLKEKkde-kcIENMEEMIEFMATDNSNEKYK-HSSfgeflk 444 Caenorhabditis ...
XP_012063483 396 settsdnsIKKVKND---IDHKAsnTDTKKKGIAIELTGKQVRkdferlNKLRNWQPSKQIMIQSTPNGSILCS------ 466 Atta cephalotes
XP_011143472 401 atSGNNEKTKKTKDE---QKTKVi-TDVKKKGVTVELTSNQSRldherlNKLRGWQPTKQVMMQSTTNGPVLCS------ 470 Jerdon's jumpin...
1_pfamImport   6 GALQLKKHLVQGGQS---VSKD---ASPVQSITASDLLKQQKQmqrellLNRRRRADDIQKGALPHSAGPGPNA------ 73 
XP_014327614 533 GALQLKKHLEQDSQL---ASSDAa-GAPLQSISASDLLKQQKRkqrellESRRHR---VQQRAPQNPG------------ 593 southern platyfish
XP_019202607 493 GALQLKKHLTQGSQSvskETS----GAPLQSISASDLLKQQKRkqrellESRRKRVEEVQKRSLENSGG----------- 557 Nile tilapia
Q28E45       572 -TLVSSERSVFQSPKQGAEFPNA-----QKMA---TPKLGRGFAEGEDVLFFDISPPAA--KSNTSAQATKLAAIQKLQA 640 tropical clawed...
XP_022526968 584 --RPAVNRGALLSPKAASEVPKRssppeRRLSappIPTLGRGFSEGDDI-LLDMSPPPR----SKSLSSAKLAAVRKLQA 656 Mexican tetra
Q5RHY1       556 --RPNVSRGPLLSPKAASEGPKGs---gSSLSgpaVPTLGRGFSEGEDI-VFDMSPPSS-----KSLSATKLAAVRKLQA 624 zebrafish
Q9U2C2       442 aDTRREKAATVDLRASSATSGTSa----SSPGgskLWTMSLANKKAAPLg-----------HKDAQEHAARLRAIAILKA 506 Caenorhabditis ...
EFP02465     445 aDTENEKSKVVDLRSSSSSITTT-----SSPNgskLWTMSM-TKNNKPVg-----------HKDAQEHAARLRAIAILKA 507 Caenorhabditis ...
XP_012063483 467 -SP-MQLKESNPSKSTDNLQSNRid-kiGLASltlRPRLGTGSNQNT----IDFSEP----ITKQQIHNAKMNAIKWVQE 535 Atta cephalotes
XP_011143472 471 -SPSVQPKGSNLTAS--KLKTNPmdkkiSLTSlssNPRLGTGCKQGM----IDFSEP-----TKQQVRSAKMNAIKWVQQ 538 Jerdon's jumpin...
1_pfamImport  74 -LSSSMGRQARMSPKEASEVPRAt----QSPAaphGPTLGRGFSEGEDIVFFENSSPPPpaPVTLSLSAAKLSALKKLKA 148
XP_014327614 594 -STATTGRASLTSPEAASEVPMAts---------dAPTLGRGFSKGDDILFFDNRRPQAppPSAVSLSAAKLAALKKLRG 663 southern platyfish
XP_019202607 558 ----ATGQHCLMSPKAASEVPTAs----QSPAaphTPTLGRGFSKGDDILFFDTSPPPApsPSTLSLSAAKLSALKKLRA 629 Nile tilapia
Q28E45       641 KGQTLTKADPNS------IKRKR-SSSaeeLVAQRVASHAPASt-----------KSPDENEP-AMKKHREQLAYLEsKE 701 tropical clawed...
XP_022526968 657 KGGAIVKDDPNA------VKRKRsDSG---AISARVERSLTSPegd------knaADVEEEEP-AQKRRREQLEYIQsEE 720 Mexican tetra
Q5RHY1       625 KGSVIVKEDPNA------VKRKRaNSG---DITGRVERNIVKAkvt------denSASEEEEP-AMKKRREQLEYIQsEE 688 zebrafish
Q9U2C2       507 KR--KEAEMEKLtgggggVKRKAs-------------------------------GTPTAPEP-EAKKPRSQ----KmDE 548 Caenorhabditis ...
EFP02465     508 KR--KEAEEEKRg----sVKRKAv-------------------------------RTPGENSPsDAKRSKSSSQS-KmDE 549 Caenorhabditis ...
XP_012063483 536 HGK-IKAADPNQ------VRA---------NIREKLEKNAK-----------------RQREN-DEKEERNAKKANInDK 581 Atta cephalotes
XP_011143472 539 HGK-ITAKNPNQ------VRV---------SSQEKLEKSVK-----------------RQREN-DEREERDAKRAKVnDK 584 Jerdon's jumpin...
1_pfamImport 149 KGTGLKKEDPNA------VKRKRsTDG---KINARVEKNLTSPng--------glSGNDEEEP-ALKRKREQLRYIQsEE 210
XP_014327614 664 KGAALEREDPNA------VKRKRsDSS---DINARVEKNRTSPng--------gpSGNGEEEP-ALKKKREQQRYVEsEE 725 southern platyfish
XP_019202607 630 KGTGLVKEDPNA------VKRKRsDSS---EINARVERNRTSPsgtrcsffrceaSANEDEEP-AQKKKQEQLNYVQsEE 699 Nile tilapia
Q28E45       702 FQKILNAKSKHTGILKEAEAEIQERYFDPLVKKEQLEEKMRSIREQE-CRVVTCKTCKYTHFKPKETCVSENHDFHWHNG 780 tropical clawed...
XP_022526968 721 FQRILNAKSSNSWIMGEVEAQAMQDYFDPLVQKEKLEEKMRGIREMK-CRAVTCKNCKYTHFKPADRCVEEKHDYHWHDA 799 Mexican tetra
Q5RHY1       689 FQRILNAKSSNSWMMGEIEERAMQEYFEPLVQKEKMEEKMKSIREMK-CRAVTCKTCKYTHFKPADRCVEEKHDYHWHDA 767 zebrafish
Q9U2C2       549 IRAMLARKSTHHKEAEKAEHDMLQRHLTGMEEREKVETFTTTCVEVKnVKVVTCNQCKYTSQFASSECIKKEHKLIKHTA 628 Caenorhabditis ...
EFP02465     550 IRALLARKSTHHKEAEKAEHDMLQRHLTGMEEREKVETFTSTCMEVKnVKVVTCNQCKYTSQFASSECMKKEHKLIRHTA 629 Caenorhabditis ...
XP_012063483 582 FKEMLEAKSSHADLIEKSYDEEKEKYFNKLEAKERMEEKMMNTFKIN-CKAVKCMLCKYTAFSASDMCKEQRHPLRVMDA 660 Atta cephalotes
XP_011143472 585 FKELLAVKSSHTDLIEKSYDEEKEKYFDKLEAKERMEEKMMNTFKVN-CKAVTCLTCKYTAFSASDMCKEQRHPLRVVDA 663 Jerdon's jumpin...
1_pfamImport 211 FQKILNAKSRHDAALQAAEYQLQESYFDPLVKKEQMEEKMKAIREMK-CRAVTCKKCSYTYFKPADRCVEENHNLRWHDA 289
XP_014327614 726 FQKILNAKSRHSVALQASEYQLQERYFNVLVKKEQMEEKMKAVREMK-CRAVTCRKCSYTYFKPADRCVTENHELRWHDA 804 southern platyfish
XP_019202607 700 FQKILNAKSRHGVILQAAEYQLQERYFNVLVKKEQMEEKMRNIREMK-CRAVTCKKCSYTYFKPADRCVEENHDLRWHEA 778 Nile tilapia
Q28E45       781 VKRFFKCA-CGNRTISLDRLPKKHCSTCGLFKWERDGMLKEKTGPKIAGETLLPRGEEHGKFLNS 844 tropical clawed frog
XP_022526968 800 TKRFFKCP-CGQRKICLARLPTAACSNCGLFKWERDGMLKEKKGPKIGGELLLTRGEEQPKFLNS 863 Mexican tetra
Q5RHY1       768 VKRFFKCP-CGQRKICLARMPHGACSHCGLFKWERDGMLKEKKGPKIGGELLMPRGEEQPKFLNS 831 zebrafish
Q9U2C2       629 DKRFFKCTgCKKRTVCFEMMPVKHCAHCNENKWERVAMKDERK-VVLDTENLLLRGEER-PFVGS 691 Caenorhabditis elegans
EFP02465     630 DKRFFKCTgCKKRTVSFEMMPTKHCPHCNENKWERVAMKDERK-VVLETENLLVRGEER-PFVSS 692 Caenorhabditis remanei
XP_012063483 661 VKRFFKCAdCGNRTVSLNRMPSHSCGKCSSSNWIRAAMMDEKK-TAIVAETLSIRGAEE-KFLGS 723 Atta cephalotes
XP_011143472 664 VKRFFKCAdCGNRTVSLYRMPSHTCGRCNGSSWARAAMMDEKR-TVIAAATLSIRGAEE-KFLGS 726 Jerdon's jumping ant
1_pfamImport 290 TKRFFKCP-CGQRAIALDRLPNKTCGNCGLFKWERDGMLQEKKGPKIAGELLQPRGEEHGKFLNS 353
XP_014327614 805 VKRFFRCP-CGQRAIALDRLPHKHCSNCGLFKWERDGMLKEKTGPKIGGELLQPRGEEHAKFLNg 868 southern platyfish
XP_019202607 779 MKRFFKCP-CGQRAIALDRLPHKHCSNCGLFKWERDGMLKEKTGPKLGGELLLPRGEEHAKFLNS 842 Nile tilapia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap