Conserved Protein Domain Family
DUF1979

?
pfam09322: DUF1979 
Domain of unknown function (DUF1979)
Members of this family of functionally uncharacterized domains are found in various Oryza sativa mutator-like transposases.
Statistics
?
PSSM-Id: 401310
View PSSM: pfam09322
Aligned: 2 rows
Threshold Bit Score: 110.717
Threshold Setting Gi: 1383076423
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WGS:AAAA:OsI_31234 496 MSSKLIFDFYYGEGNVRCGQNGVDLSEFKCMTRGIERAAERSFEAVCNWLIRGFRIDP 553 long-grained rice
WP_108257552         1 MSSKVTFQIVHGEGNIRFGPDGVDLSDFVMTSKGIDRPAERTFQSIYSWLLRGFRIDQ 58  Mangrovicoccus ximenensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap