Conserved Protein Domain Family
Glyco_trans_A_1

?
pfam09318: Glyco_trans_A_1 
Glycosyl transferase 1 domain A
Glyco_trans_A_1 is family of found predominantly at the N-terminus of various prokaryotic alpha-glucosyltransferases. According to whether the domain exists as a whole molecule or as a half molecule determines the number of sugar residues that the molecule transfers. Two-domain proteins are processive in that they transfer more than one sugar residue, processively; single domain proteins transfer just one sugar moiety.
Statistics
?
PSSM-Id: 370428
View PSSM: pfam09318
Aligned: 2 rows
Threshold Bit Score: 314.282
Threshold Setting Gi: 961480222
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P13484    20 YFISGGLPSNYGGLTKSLLLRSKLFGEEcNQNTFFLTFRFDLELSSKIDELYSNGKIDKKFTSVINLFDDFLSVRTNGKR 99  Bacillus subtilis s...
ABV63882   4 YFITGRIKEKYGGMTKSLLLRANLFGLK-NISTHFLTFSYDQEFSQKVKGIFDKQIVDPNVTKIQNMYEDFLIPNCSPKE 82  Bacillus pumilus SA...
P13484   100 SYeerigldQIKKQVGMGKFAktllrlFGKKNNEMSVVYYGDGETIRYVDYWNDKNQLIKREEYTKNGNLVLVTHYDVQL 179 Bacillus subtilis s...
ABV63882  83 QY-------QPTYHAGNNKGS------FDHEDPSVRMIRNEKSNQIEIVDYFHPNQQLEKREEYNSQGQLHKVSYFSQET 149 Bacillus pumilus SA...
P13484   180 NKMYLQEYINDQNQVYLDKLYVWNNEEKDVQLSHIIWYS 218 Bacillus subtilis subsp. subtilis str. 168
ABV63882 150 GKVYRELFIYENTHIYMKKGYADLKEEAKSKLRDIIWYS 188 Bacillus pumilus SAFR-032
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap