Conserved Protein Domain Family
Rab5-bind

?
pfam09311: Rab5-bind 
Rabaptin-like protein
Members of this family are predominantly found in Rabaptin and allow for binding to the GTPase Rab5. This interaction is necessary and sufficient for Rab5-dependent recruitment of Rabaptin5 to early endosomal membranes.
Statistics
?
PSSM-Id: 401304
View PSSM: pfam09311
Aligned: 4 rows
Threshold Bit Score: 360.822
Threshold Setting Gi: 1043433119
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
OCA45746 524 CDMCSNYEKQLQGIQTQEAEIRDQVKKLQSMLRQVNDQLEKTLKDKKDLEDYMKQNTEETSTQISTLTIRTNQSETLLAD 603 tropical clawed frog
Q19088    37 CEMCQNYEVNLTALQENERKLKEEVKAAMELNERYQLDLSNERDYRKELEKKMNELSTNCLNQVNEAAKANAKSEQRLDE 116 Caenorhabditis elegans
O35550   533 CDMCSNYEKQLQGIQIQEAETRDQVKKLQLMLRQANDQLEKTMKEKQELEDFLRQSAEDSSHQISALVLRAQASEVLLEE 612 Norway rat
TNM85253 528 CDMCSNYEKQLQAIQGQEAETRDQVKKLQVMLRQANEQLERTMTDKQNLEDSVQAGNKETAAKVSTLLHRVQESETLLSS 607 Takifugu bimaculatus
OCA45746 604 LQQAFTQAKRNIQDQMAVLMHSREQVSEELLRLQRDNESLQGKHSLHVSLQQAENFSLPETSEELQNLVLKYREDIISVR 683 tropical clawed frog
Q19088   117 LSAKHDKSIEVFTDQLNLARDKLQQADDDFVTLGKKYKKLLGSTRKSAQELRSEKIDMPADLDQLQFICLKNREELIETR 196 Caenorhabditis elegans
O35550   613 LQQSFSQAKRDVQEQMAVLMQSREQVSEELVRLQKDNDSLQGKHSLHVSLQLAEDFILPDTVQVLRELVLKYRENIVHVR 692 Norway rat
TNM85253 608 LQLAFSEAKRNTQENLMVLVKSREQVADELNRLQRDNESLQGKHKLHVELQQQEGFQMPDNVQELQELVVQLRDHLVALR 687 Takifugu bimaculatus
OCA45746 684 TAADHLEEKLKAEILFLKEQIQAEQCQKENIEETLQIEIENCKEEIASTSSLKLELDRVKAEREQleaslqeKTRALQNL 763 tropical clawed frog
Q19088   197 AAKEHTEQQLQDEITVLRAQILEERAHREDQEVTFTAEISRLQSELGKINTRMVVASETIADQDS-------NIRQIRDL 269 Caenorhabditis elegans
O35550   693 TAADHMEEKLKAEILFLKEQIQAEQCLKENLEETLQLEIENCKEEIASISSLKAELERIKVEKGQlestlreKSQQLESL 772 Norway rat
TNM85253 688 TSFDHMEEKLKAEILFLKEQIQAEQCLKENLEDTLQVEIEGYKEEIASFSRLKTELEQIRVEKEQlqngvteKAELLEKL 767 Takifugu bimaculatus
OCA45746 764 QTLKDSLEDQLKKETGGKASLEQLVFEEKNKAQRLQTELDVSEQVQRDFVKLSQTLQVQLERIRQTD 830 tropical clawed frog
Q19088   270 QTTVGELETQVQQVQNERAAVEQTAQNYKQRCTSLQQELDTSEVVQRDFVKLSQSLQIQLEKIRQSE 336 Caenorhabditis elegans
O35550   773 QEIKVNLEEQLKKETAAKATVEQLMFEEKNKAQRLQTELDVSEQVQRDFVKLSQTLQVQLERIRQAD 839 Norway rat
TNM85253 768 QSMKISLEQQLKDLSDTKAALEAQVLDEKAKAQRLQTELDVSEQVQKDFVKLSQTLQVQLERIRQAD 834 Takifugu bimaculatus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap