3C30


Conserved Protein Domain Family
LuxQ-periplasm

?
pfam09308: LuxQ-periplasm 
Click on image for an interactive view with Cn3D
LuxQ, periplasmic
Members of this family constitute the periplasmic sensor domain of the prokaryotic protein LuxQ, and assume a structure consisting of two tandem Per/ARNT/Simple-minded (PAS) folds.
Statistics
?
PSSM-Id: 401301
View PSSM: pfam09308
Aligned: 8 rows
Threshold Bit Score: 273.852
Threshold Setting Gi: 372983968
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3C30_A               10 SSRLXAQEGQRTSVQTSSLIQSLFDFRLAALRIH----QDSTAKNASLINALVSRD-SSRLDEFFSSVDELELSNAPDLR 84  Vibrio c...
WP_012600320         40 SSRIVKQETNRTVKQTSSLIQNMFDYRLSVLQIHqdspQDSSSHSETLREYFDTNN-EEALSYFFYGVDQREPDHAPDLR 118 Vibrio t...
Q87GU5               40 SKQIIWQEVDRTKQQTSALILNIFESHFAAIQIH----HDSNSKSDVILDFYSERN-EEALNYFFLSIDQSDPSHTPEFR 114 Vibrio p...
Q7MD16               40 SNKIIKQEVMLTKQQTSALVKSLFNNHLSILQIH----HDSNSKNEAIRRFFLDGD-DEKLEYYFLSMDQADPTHTPEFR 114 Vibrio v...
IBRC:GU3_02305       42 SA-MIDDSIHQQLEEANGRLQILLDSYLSSLDSL----LSTAAEQPELAQALSSGN-RQAAEAQLQEILANRHGEYLDLL 115 Oceanimo...
KJY76495             39 SSSIIKQEVARSSTQTSSLLQNLLDYKLATLQSH----QDSNALNITLQNNLISNS-PDQVDFFFLDLEQNDPLNSPDFR 113 Vibrio n...
Q5E6Z3               35 SVNTINEEVKRNLQQTSGIINNFFEHRLSILQIR----QDTDAESLAIYDQYIESDyKNKLNTYFSNIEAKSPYNSPDFR 110 Aliivibr...
JLExeter:vfu_B00358  41 SSRLISQEVARTSTQTSSLIQNLFNYRLATLQIH----QDSSAKNASLIQALNSDS-GAALDQYFLSVDQLELNNTPDIR 115 Vibrio f...
3C30_A               85 FISSHDN-ILWDDGNASFYGIAQQELNKLIRRVAISGNWHLVQTPSEGKSVHILXRRSSLIEAGTGQVVGYLYVGIVLND 163 Vibrio c...
WP_012600320        119 FVSTYNG-LAWEDGNGQFYGLDESSLKHISDEVAFSSNWHFIQLTTDIGKRHLLARRTPIVDNKTGEVLGQLYVAIVLDN 197 Vibrio t...
Q87GU5              115 FLTDHQG-IIWDDGNAHFYGINDSMLDGLTSKVTFSNNWYYVTSITSMGARHLLLRRVPVLEPKTGEVMGYSYNAVVLDN 193 Vibrio p...
Q7MD16              115 FLTTGEG-LLWDDGNAHFYGVNEVLLEKISQSVLFGNNWHFMSLHTLMGLRNMLVRRSPVIDTTTGEVLGQYYISVVLDN 193 Vibrio v...
IBRC:GU3_02305      116 VLSRQEQ--PWVHLNSPLYTM-EHRLQQLLTTPPLYHRWAGLELDAPFSRQVALVQRYPVIAQASGQVIGNLLGGVVLND 192 Oceanimo...
KJY76495            114 FITSDNGdVNWNDGNGLFYGLTEVHLERISTSISLGRDWHYISQDTVLGERNLLIRRTPIISLENGQVLGHLYIAIVLNR 193 Vibrio n...
Q5E6Z3              111 FIEVNNK-LYWDDGNSSFLSLNENCLKIIIKKNLNINTWYYIKMKEPLSEADFLIRKTPIVNNDSGRIVAFIYNAVMLNN 189 Aliivibr...
JLExeter:vfu_B00358 116 FITDLKE-MVWEDGNSQFYGVPPKELNKIIRKVSISSNWHLIQTPSVLGTAYLLVRRSPIVDTATGEVIGFLYVSTVLNN 194 Vibrio f...
3C30_A              164 NFALLENIRSGSNSENLVLAVDTTPLVSTLKGNEP-YSL---DYVVHSAKDAXRDs--fIVGQTFLEVESVPTYLCVYSI 237 Vibrio c...
WP_012600320        198 NFSLAESIQQGSNCENIVIEAHGTPVTSTFSGDES-YTIk--DVLSYEMYEQLPRh---FVTIATIKINAVETPLTIRAI 271 Vibrio t...
Q87GU5              194 NFALMEKLKNEGNVDNVVLVANDIPVASSLAGDES-YKIf--DVLKRKETQKKLDq--lLIIQTPIEVNAAITNLKLLTV 268 Vibrio p...
Q7MD16              194 NFPLVEMLESGSNSDNIVMLVGDKVISHSLSGNEP-YDLd--SLLAMRDEPSAFDd--cLISHTPIEINSTDTLVSILAI 268 Vibrio v...
IBRC:GU3_02305      193 NLSLLQHLARGAENVRVQLIRRGKPVSPAYLSNNDiAPMvftQALSSGRRDGQIQg--hYFRLRPLLINGEPSELQLLLL 270 Oceanimo...
KJY76495            194 NLSLIDQLQVASNSDAVIMMIDYTPIASTINSEDPlYN----EVLEDLNQDNTGSsgghLFNATNLLVNGEDTPIYVYTI 269 Vibrio n...
Q5E6Z3              190 NISFLNKLKKLTNSQDVFIINDNKILASSVSSNTEiYQEv--TSILNGTRKRIPSk---ILNFTPINIKSMSGEISILSL 264 Aliivibr...
JLExeter:vfu_B00358 195 NFTLIETIRDSSNSQNLILTVGSEVLASTLNGDES-YSTf--DVLEDGLSDALYDk--nMVAKTALEVEGVPTYLSIYSV 269 Vibrio f...
3C30_A              238 QTNQNVLTL 246 Vibrio cholerae
WP_012600320        272 QKNTNLIAL 280 Vibrio tasmaniensis
Q87GU5              269 QDNQSVVTL 277 Vibrio parahaemolyticus RIMD 2210633
Q7MD16              269 QENSHVASL 277 Vibrio vulnificus YJ016
IBRC:GU3_02305      271 TDNTiaqql 279 Oceanimonas sp. GK1
KJY76495            270 QTNSNILTL 278 Vibrio nigripulchritudo
Q5E6Z3              265 KNKDNIELL 273 Aliivibrio fischeri ES114
JLExeter:vfu_B00358 270 QSNENALSL 278 Vibrio furnissii NCTC 11218
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap