1TFR


Conserved Protein Domain Family
RNaseH_C

?
pfam09293: RNaseH_C 
Click on image for an interactive view with Cn3D
T4 RNase H, C terminal
Members of this family are found in T4 RNaseH ribonuclease, and adopt a SAM domain-like fold, consisting of a bundle of four/five helices. These residues may have a role in providing a docking site for other proteins or enzymes in the replication fork.
Statistics
?
PSSM-Id: 401290
View PSSM: pfam09293
Aligned: 2 rows
Threshold Bit Score: 225.27
Threshold Setting Gi: 157833933
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1TFR_A 183 GSAEIDCMTKILKGDKKDNVASVKVRSDFWfTRVEGERTPSMKTSIVEAI-ANDREQAKVLLTESEYNRYKENLVLIDFD 261 Escherichia virus T4
Q6WIF0 188 GSPEMDIMYKCIKGDKKDGIAPLKAPSDHY-THGDGRRAPSVRKEELRTLmTSTPEELKKLLTDEQYARYEENRKLLDFA 266 Vibrio phage KVP40
1TFR_A 262 YIPDNIASNIVNYYNSYKLPPRGKIYSYFVKAGLSKLTNSINEF 305 Escherichia virus T4
Q6WIF0 267 FIPEHISDSIIEQFETQKPAPRSKIMMYFASKKLDKLIESMSEF 310 Vibrio phage KVP40
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap