Conserved Protein Domain Family
Taq-exonuc

?
pfam09281: Taq-exonuc 
Taq polymerase, exonuclease
Members of this family are found in prokaryotic Taq DNA polymerase, where they assume a ribonuclease H-like motif. The domain confers 5'-3' exonuclease activity to the polymerase.
Statistics
?
PSSM-Id: 370405
View PSSM: pfam09281
Aligned: 9 rows
Threshold Bit Score: 149.152
Threshold Setting Gi: 94556047
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
zhongguo:DGo_CA1437  353 DEWAALAVAdPAPLFGelt-rsdKPLTKTQQKAAE----KATRDAEKRAEKLRqqyp----atvdEAEFASQGTVTAAAA 423  Deinoc...
AEB11877             296 AEEAPWPPP-PEAFLG-------YVLDRPQPMWAElkglAGAWEGRVARGPAR------------AKELARFEAVHALQA 355  Marini...
jgi:Ocepr_1055       301 aQEAAWPPP-ERAWLG-------YVFDRPEPMWAElgqlAAAWDERVAEGPAR------------ALELERFPQLDAVQA 360  Oceani...
pacbio:K649_11105    304 AEEAPWPPP-PEAFLG-------YTLDRAQPMWANwlglAAYAGGKVYRGQPS------------LQELKKFPEIRSMVA 363  Meioth...
P52028               296 LEEAPWPPP-EGAFVG-------FVLSRPEPMWAElkalAACRDGRVHRAADP------------LAGLKDLKEVRGLLA 355  Thermu...
jgi:Dgeo_1666        367 DAAAP-----EGPLFGdppaaapRKLSKKAQQAAE----RAAQKAAERRAALFppi-------vsEAEFVGQREVTAAGA 430  Deinoc...
P52027               411 DEWAQAEA--PENLFGell-psdKPLTKKEQKALE----KAQKDAEKARAKLReqfp----atvdEAEFVGQRTVTAAAA 479  Deinoc...
WP_015236905         306 ptLAPWQTPtEGVIWG-------YRLTREDDLQAEla-eVATWDGEAARVLEQv----------eLAEFVGQRSVNAINA 367  Deinoc...
jgi:Deima_1440       309 PATEAWTTPtEDAAWG-------YRLSREDELSAHll-dAATFGAEVARVAPHasaeegatpsvdLSAFEGVRVVNAVNA 380  Deinoc...
zhongguo:DGo_CA1437  424 KALATHLSVRGTVTEPGDDPLLHAYLLDPANTNMPVTAQRYLGEGWPADAPGRAAMTARLLEALPGQL 491  Deinococcus gobien...
AEB11877             356 KDLTVWARREGVRVQPGEDPLLLAYLYDPTNSDPAATVRRYGAGDWSEDPAARALAAAELWRILGERL 423  Marinithermus hydr...
jgi:Ocepr_1055       361 KDLTVWALREGVRARPGDDPLLLAYLYDPSNNQPASTVRRYGVGDWTDRARDRALAARWLWREMSDRL 428  Oceanithermus prof...
pacbio:K649_11105    364 KDLSVLALKEGVWVPPGDDPMLLAYLYDPSNSDPASTVRRYGAGDWGSDPGERAQAAHTLWETLQSRi 431  Meiothermus ruber ...
P52028               356 KDLAVLASREGLDLVPGDDPMLLAYLLDPSNTTPEGVARRYG-GEWTEDAAHRALLSERLHRNLLKRL 422  Thermus thermophil...
jgi:Dgeo_1666        431 KALAAHLSVRGTVVEPGDDPLLVAYLLDPANTNMPIVAERYLRTTWPEDAATRAAITYRLLQDLPPHL 498  Deinococcus geothe...
P52027               480 KALAAHLSVRGTVVEPGDDPLLYAYLLDPANTNMPVVAKRYLDREWPADAPTRAAITGHLLRELPPLL 547  Deinococcus radiod...
WP_015236905         368 KALATHLMVRGVNVLPGEDPMLMAYLIDSAVTTPQLACEKHLGHAWPDQAAGRAVAGGRLLDALQDKL 435  Deinococcus perari...
jgi:Deima_1440       381 KALATHLQVRGVSVEPGEDPLLIAYLLDNTVTNASLLAQAHLGAPWPDDAPTRALATAQLLTALRPQL 448  Deinococcus marico...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap