Conserved Protein Domain Family
Hepsin-SRCR

?
pfam09272: Hepsin-SRCR 
Hepsin, SRCR
Members of this family form an extracellular domain of the serine protease hepsin. They are formed primarily by three elements of regular secondary structure: a 12-residue alpha helix, a twisted five-stranded antiparallel beta sheet, and a second, two-stranded, antiparallel sheet. The two beta-sheets lie at roughly right angles to each other, with the helix nestled between the two, adopting an SRCR fold. The exact function of this domain has not been identified, though it probably may serve to orient the protease domain or place it in the vicinity of its substrate.
Statistics
?
PSSM-Id: 401275
View PSSM: pfam09272
Aligned: 11 rows
Threshold Bit Score: 155.665
Threshold Setting Gi: 938079095
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_006114828  50 GLYGVQVSSGDLRVTLYDESEGKWRLICSTPSNALVAALSCEEMGFVRSLWHSELDVELAGANGTSGYFCVDESRLPLAQ 129 Chinese soft-sh...
XP_014452395  57 ALYGVQVSPADLRLTVFDEAEGRWRLVCSSPANALVAALSCEEMGFVRSLWHSELDVERAGANGTSGFFCVDEARLPLAS 136 American alligator
XP_006641623  50 RLYDVQINPADLRLSVFDRSDGRWKFVCSSSSDELVARISCEEMGFIRSLGYSVHPFSSVSGNTSEGFFCVDEKQLEFGK 129 spotted gar
CAP09626      53 GLFDVQVSAADQRLRVFDSTQWRWKYVCSSSVNQLIANITCEEMGFVRAVNFSVTCAPESGGD--RDFFCVKESELTYGK 130 zebrafish
NP_001120287  50 NLYIVQVNLPDHRLSVYDEKEKVWRLVCSSFSNPEVATLSCEEMGFIRSVSHQELRVETAGTNGTSGYYCVHESQINSAK 129 tropical clawed...
KPP75178     169 VFY--RISPENSLLEIQLEKLQTWLPVCYEHWNSSLGTLVCRQLGYLRLTKHKGVHLRDIGPNYTDGFLQITPEHQRSLE 246 Asian bonytongue
4_pfamImport   1 ALYDVQISSADSRLLVYDRSEKVWRMVCESNLNLVLATMSCQAMGFVSSTSSRPLHLRSSASG--SHFDLTSPQILDHAR 78 
XP_008115265  50 SLYAVQVSPGDLRLTIYDENEGKWRLLCSSSHNAQVASLSCEEMGFVRSLSHSVLAADSAGSNGTSGYFCVDGSRLPYAR 129 green anole
3_pfamImport   1 FLYLVQVSPGDSPLMLFDETGGTWWLLCSLCSNARVARLSCKEMGFLRALAHSELD-----GDGTLGF-CIDKGRLSHVR 74 
XP_023355774  50 vlypVQVSPADLRLTVFDGAEGTWRLLCSSRANSRVASLSCEEMGFIRALSHSELDVRMFGTNGTSGYFCVDEERLPYAR 129 Tasmanian devil
XP_028437384   6 glydVQVNSADQRLRVFDSAQRRWRQVCSSSANELLASISCEEVGFISVVNYSVTSVPEASGDGGE-FFCVRQQELSYGK 84  yellow perch
XP_006114828 130 RLSEVVSICDCPMGQFLATLCQDCGRR-KLS 159 Chinese soft-shelled turtle
XP_014452395 137 GLAEVVTACECPSGRFVATLCQECGRR-KLP 166 American alligator
XP_006641623 130 KIKEVLSACDCENGRILSVNCQDCGRR-KLT 159 spotted gar
CAP09626     131 KIKTALYPCKCDKGQILEVICQDCGRR-MLP 160 zebrafish
NP_001120287 130 RLLDILTVCECPSGRFLSVQCQDCGRR-KLA 159 tropical clawed frog
KPP75178     247 NIWQFRG--SCITGKVIALKCFECGTRaKLP 275 Asian bonytongue
4_pfamImport  79 SLTLMSDVIECPSGRVLAVQCQDCGRR-KVP 108
XP_008115265 130 MLSEALVVCECPTGRFLATLCQDCGRR-KLS 159 green anole
3_pfamImport  75 SLLEV-TLCDCPRGYFLATICQDCGCR-KLP 103
XP_023355774 130 RLAEVISICDCPRGLFLATLCQDCGRR-KLp 159 Tasmanian devil
XP_028437384  85 KIKDSLFPCDCESREVLTLLCQDCGRR-SFA 114 yellow perch
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap