1WLF


Conserved Protein Domain Family
PEX-2N

?
pfam09263: PEX-2N 
Click on image for an interactive view with Cn3D
Peroxisome biogenesis factor 1, N-terminal
Members of this family adopt a Cdc48 domain 2-like fold, with a beta-alpha-beta(3) arrangement. It has been suggested that this domain may be involved in interactions with ubiquitin, ubiquitin-like protein modifiers, or ubiquitin-like domains, such as Ubx. Furthermore, the domain may possess a putative adaptor or substrate binding site, allowing for peroxisomal biogenesis, membrane fusion and protein translocation.
Statistics
?
PSSM-Id: 401268
View PSSM: pfam09263
Aligned: 15 rows
Threshold Bit Score: 122.833
Threshold Setting Gi: 390357797
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1WLF_A         15 VTVAFTNARDCFLHLPRRLVAQLHLLQNQAIEVASDH-QPTYLSWVEGRHFNDQSENVAEINRQVGQKLGLSSGDQVFLR 93   house mouse
XP_005478692   10 VTVTFNNAKNCFLHLPLKLISQLSLNENQPLELSCGHgPPVFLTWTQNRASSSLDSHKVELCRQLGEKQGLTDGEQGFLR 89   Nile tilapia
XP_011479492   10 VCVVFNNTKNCFIQLSSKLISHLSLNENQALELSWDGgSTVFLSWCPIRASLGADSHRVELSRQLGEKLGLTDGEQCFLR 89   Japanese medaka
XP_003222152   12 ASASLSGARDCFLHLPPGLASSLRLQQDQAVKTSWDN-QTVFLGWTEIRRCQCSG-NIVEINRQLAEKLGIKDGQQVFLQ 89   green anole
XP_005041158   13 ATVVLSGTRDCFLHLPPALASLLRLQQGQAVKISCGH-QPIFLSWMETRHRGHQGENIAEINRHLAEKLGITDGEQVFLE 91   Collared flyc...
XP_001368768   18 VTVSFSHARDCFLHLPRALAAQLHLQQNQAIEVSWGH-QPIFLSWVEGKHQTNQGENVAEINRQFGQKLGISDGEQVFLR 96   gray short-ta...
XP_002713855   17 VTVVFTNARDCFLHLPRRLVAQLHLLQNQAVEVAWGR-QPVFLSWVEGRRFSDPGESVAEISRQVGRTLGLADGGQAFLK 95   rabbit
XP_014347945   10 VALKFTNSKNCFVYLPSHLVSQLHLQEGQAVELSWDFrRSAFLSWV--RHAGFCDEKEIGINRHLGEKLGLTDGEEVLLR 87   coelacanth
XP_005797465   12 iRVVFNNAKNCFLHLPSKMISHLSLQENQTLELSWDNaSPVYLSWTQNRASSDPHSNDVELCRQMGEKLGLKDGEQGFLK 91   southern plat...
XP_029298959   10 VTFVFNNAKNCFLHISSKLISHLSLNENQALELSWGHgSPVFLSWTQNRTSSSLDSHKVELCRQLGEKLGLKDGEQGFLR 89   Cottoperca gobio
1WLF_A         94 PCS 96   house mouse
XP_005478692   90 PCH 92   Nile tilapia
XP_011479492   90 PCH 92   Japanese medaka
XP_003222152   90 PCS 92   green anole
XP_005041158   92 PCS 94   Collared flycatcher
XP_001368768   97 PCS 99   gray short-tailed opossum
XP_002713855   96 PCS 98   rabbit
XP_014347945   88 ACT 90   coelacanth
XP_005797465   92 PCH 94   southern platyfish
XP_029298959   90 Pch 92   Cottoperca gobio
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap