5JM0,3CZN


Conserved Protein Domain Family
Alpha-mann_mid

?
pfam09261: Alpha-mann_mid 
Click on image for an interactive view with Cn3D
Alpha mannosidase middle domain
Members of this family adopt a structure consisting of three alpha helices, in an immunoglobulin/albumin-binding domain-like fold. They are predominantly found in the enzyme alpha-mannosidase.
Statistics
?
PSSM-Id: 401266
View PSSM: pfam09261
Aligned: 45 rows
Threshold Bit Score: 91.9513
Threshold Setting Gi: 81849926
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5JM0_A  578 EFHRGTYTSQAQTKKLMRLSEIKLHDLEWIAA-----------KTSv---LYPDSYKYPSKQINELWENVLLCQFHDVLP 643  Saccharomyces cerev...
Q28949  347 QTWTGFYTSQSGLKRLARRASALLYAGESLFT-----------RYMlsaaHRFLDPAWALTQLQQLRWAVSEVQHHDGIT 415  pig
O54782  356 QAWTGFYTSRSTLKGLARQASALLYAGESMFT-----------RYMwpdpSGTLDPTWALQQLQQLRWAVSEVQHHDAIT 424  house mouse
Q9VLI0  357 SFWTGYYTSRPTQKRFERDGNHILQVAKQLSAfaels------------------stqqkEDLEYLREIMGVMQHHDAIT 418  fruit fly
Q8MS44  358 SYWTGYFTSRPTQKRFERDGNHILQVAKQLSVfaeln------------------tkqqkEDLEYLREVMGVMQHHDAIT 419  fruit fly
Q20829  356 SYWTGYFTSRPAFKGMIRQASCMLQLAKQLDVianlgpeddsdIEI-------------------LREASALVQHHDAVT 416  Caenorhabditis elegans
O00754  386 QFWTGYFSSRPALKRYERLSYNFLQVCNQLEAlvgla---------------anvgpYGSGDSAPLNEAMAVLQHHDAVS 450  human
Q9FKW9  364 AYWTGYFTSRPALKRYVRALSGYYMAARQLEFlvgknsggpntYS--------------------LGDALGIAQHHDAVT 423  thale cress
P94078  355 AYWTGYFTSRPAFKKYVRDLSGYYLAARQLEFlrgrdssgpttDM--------------------LADALAIAQHHDAVS 414  thale cress
Q8LPJ3  355 AYWTGYFTSRPALKRYVRVMSAYYLAARQLEFfkgrsqkgpntDS--------------------LADALAIAQHHDAVS 414  thale cress
5JM0_A  644 GSCIEMVYKyEAVPMLHNVVKECTSLIDKTVQFL 677  Saccharomyces cerevisiae S288C
Q28949  416 GTHILAVRD-MFVEHLTTGMAGVRKLMDSIAQDM 448  pig
O54782  425 GTESPKVKN-MYTEHLRMGMLGVRKLMVSIAlgg 457  house mouse
Q9VLI0  419 GTEKQHVSD-DYDRILYDAIVGGVKTAGDALRKL 451  fruit fly
Q8MS44  420 GTEKQHVSD-DYDRILYDAILGGVNTARDGLRKL 452  fruit fly
Q20829  417 GTAKENVTR-DYEKQLAKGVSEVEVVINDFMKKM 449  Caenorhabditis elegans
O00754  451 GTSRQHVAN-DYARQLAAGWGPCEVLLSNALARL 483  human
Q9FKW9  424 GTAKQHVTN-DYMKRLALGASEAEAVVNSALACL 456  thale cress
P94078  415 GTQRQHVAA-DYALRLSMGYLQAEKLVASSLSFL 447  thale cress
Q8LPJ3  415 GTSKQHVAN-DYAKRLAIGYVEAESVVATSLAHL 447  thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap