Conserved Protein Domain Family
Endonuc-EcoRV

?
pfam09233: Endonuc-EcoRV 
Restriction endonuclease EcoRV
Members of this family of prokaryotic restriction endonucleases recognize the double-stranded sequence 5'-GATATC-3' and cleave after T-3. They catalyze the endonucleolytic cleavage of DNA to give specific double-stranded fragments with terminal 5'-phosphates.
Statistics
?
PSSM-Id: 401246
View PSSM: pfam09233
Aligned: 8 rows
Threshold Bit Score: 337.477
Threshold Setting Gi: 523971074
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Murru_1485  23 VSDKVGDWKVKGFIDIEKSIYTISSDTKIISKILEIQLFPKFQEFADQNGYDIVLAEKQNWYPDLSFVNKSNPKiKFAVD 102 Muricauda rue...
CCX42910        24 FIAKGDEWTIRGFIDIFKNIYTISTDTKIVSKVLELHLFPHFLTFAENIGYTIELATYQNWYPDLTFISKADPTiKFAVD 103 Clostridium s...
Q7VJK4          21 ICQPNHQWKIKGFIDSDTHIFSLSNDTKVISKILEIHIFPYILEFAKTHHFNVVLPYHQNYYPDLSFVSQKDSTiKYAID 100 Helicobacter ...
CCX54845        19 LESMKYSWNFAGLINFNNTIYPFGNDSKIIGRIFEIAAREALSMAAQKLGYIFQENPTQTVYPDFYFAIPNTDK-LIAID 97  Veillonella s...
CCX44853        21 VSTKDGQWVVKGFIDVYRHIYTISTDTKVVSKIIELYIFPLLFKFAQDNGLQLELAKEQNFYPDITFKDEDGN--LFAVD 98  Prevotella sp...
WP_002741551    21 VSTNEGEWIIKGFIDIHKKVYTISIDTKIISKILELLLFPIFDNFARCNQLKIELVSQQNFYPDLTFIHEPTGA-KFAVD 99  Microcystis a...
WP_008588239    21 IATEKGDWIVKGFIDIYKNVYTISIDTKVVSKVMEILLIPAFEKFAQKNDLKLELPPQQNFYPDLTFTCNKTGE-RFAVD 99  Niabella soli
jgi:Hneap_0201  22 ISSEDGQWTIKGFVDMYKNIYTISSDTKIISKILEIHIFPKLLELSEKHGYKIVLADHQNYYPDISFVDNDDDSvRFAVD 101 Halothiobacil...
jgi:Murru_1485 103 IKTTYRLDDYDgfCNGFTLGSHGEYFRKRTSTKNIQFPYADYTAHICLGILYTRALStDIDETKILQLNELDKITSVIKD 182 Muricauda rue...
CCX42910       104 LKTTYRDEECPgfCNGFTLGSHGEYFIERTSTKNIQYPYDEYCGHFCLGIIYSRADIsKDEETHIYSIDEVERIPAVIRN 183 Clostridium s...
Q7VJK4         101 LKTTYRNENNPklCNGFTLGSHGEYFKNRESNKNIQFPYKDYLGHFCLGVIYDRV---KIDELKRYKLDDLGKIQSVIQN 177 Helicobacter ...
CCX54845        98 IKTTYRQSSSA--SFKFTAGSFTSYL--RNGTKNIVGHYDNYIKHYIIGFVYDREES---PTTQCTHYEDRDSIIPAYKN 170 Veillonella s...
CCX44853        99 LKSSYRKTADR--INGMTLGAFTGYFRNRRSSKNVTYPYSSYKAHIVLGIIYSENDA-AIDERKLYTLDDLDDIVSVVKD 175 Prevotella sp...
WP_002741551   100 IKSTYRKNNQE--VNGMTLGTFTGYFRQRNSCKNIKYPYQEYSGHYVLGVIYTKCDL-VADERKSFRLEDIEKIPSVIKD 176 Microcystis a...
WP_008588239   100 IKSTFKDSTNK--IKSMTLGAFTGYFRNRKSTKNTLYPYGSYSAHLVLGVIYSQIEE-NPNEKTIYSIDELDKIESVIKD 176 Niabella soli
jgi:Hneap_0201 102 FKTTYRQPSKPhlCNGFTLGSHGKYFEDRTSTKNIQFPYGSYSGHYCLGIIYDRVDSrDIDETKIYSLDSLTSITSVVGK 181 Halothiobacil...
jgi:Murru_1485 183 LVFFAEEKWKISSDKGGSGNTANIGSI--QYIDDILKGNGVFKNLGEKIFDEYWINQGVLKVP-DpkkaGNFKK--LTKL 257 Muricauda rue...
CCX42910       184 FLFFAEEKWKIASDKGGSGNTANIGSI--QKIDDILNGNGVFAKAGEDIFDDYWANFGKIEIPvD----GKRKK--LSSF 255 Clostridium s...
Q7VJK4         178 LTLFFVEKYKIASDCSGSGNTANIGSI--KNIDDILNEKGVFADLGESLFDDYWINYGKITIT-Ds--qGKTKN--ITKL 250 Helicobacter ...
CCX54845       171 VEFFVQEKYKIAGEQKGSGNTDNIGTIsaNSIEPFRLGYGPFSVLGEEIFEDYWRHYPKYT---Dtk-------klYTNL 240 Veillonella s...
CCX44853       176 ITFFVQEKWKIAIDRPGSGNTKNIGSV--SLIEDLIYGNGPFSELGEAIFDDYWTNY----LTsDmakkAELASpyYNNL 249 Prevotella sp...
WP_002741551   177 FQFFAQPKYKIASSSPGSGNTKNIGSV--TKISELIEGKGIFSLLGEEVYDDYWMYY----LTtDmakqVDSSRp-YTNL 249 Microcystis a...
WP_008588239   177 FHFFVQPKYKIASASPGSGNTKNIGST--NSIDKLIKGNGVFSTLGEEVYDDYWIYF----LTkDmakaLEIPRp-YTNL 249 Niabella soli
jgi:Hneap_0201 182 FSFFVAEKWRIASDKSGSGNTANIGSI--NNIADIIEGKGMFSNLGEEWFDDYWMNYKKITVP-Dg--kGGTKK--ITNL 254 Halothiobacil...
jgi:Murru_1485 258 TEFLEFKG 265 Muricauda ruestringensis DSM 13258
CCX42910       256 EEYLRYRG 263 Clostridium sp. CAG:1024
Q7VJK4         251 SEYLTYRG 258 Helicobacter hepaticus
CCX54845       241 PTYIEWKk 248 Veillonella sp. CAG:933
CCX44853       250 GSYKKFRn 257 Prevotella sp. CAG:1031
WP_002741551   250 KSYLEYKQ 257 Microcystis aeruginosa
WP_008588239   250 KSYLEYKQ 257 Niabella soli
jgi:Hneap_0201 255 KEFVAYRK 262 Halothiobacillus neapolitanus c2
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap