Conserved Protein Domain Family
Endonuc-PvuII

?
pfam09225: Endonuc-PvuII 
Restriction endonuclease PvuII
Members of this family are predominantly found in prokaryotic restriction endonuclease PvuII. They recognize the double-stranded DNA sequence 5'-CAGCTG-3' and cleave after G-3, resulting in specific double-stranded fragments with terminal 5'-phosphates.
Statistics
?
PSSM-Id: 370372
View PSSM: pfam09225
Aligned: 4 rows
Threshold Bit Score: 237.401
Threshold Setting Gi: 504987953
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Veis_3517      11 TDKQKFERLFPCIREYQVLASKYKINDIFQDNGGKYLQLLMILGLTTDGTREGNDAVDSFGNEYEIKTVNLELQHQ--FT 88  Verminephr...
pacbio:K649_09665  75 TDIAILEALFPYIRRYQILASRYGIADIFQDNGGKLLEILIRTGLKIVPGREGNDAVDEQGQEYEIKSVNVELTRS--FS 152 Meiothermu...
WP_015175055      109 sDAKRLENAMKSIQELQNLASEYGIADIFQDNGGKTLQLLILLGLRISPGREGNDAIDAEGKEYELKTINIALNRSggVT 188 Oscillator...
jgi:Glo7428_2601  113 SDLERLQTALEAIQELQTLANEYGINDVFQDNGGKVLQVLILLGLRISPGCEGNDAIDAEGHKYELKTINKLLSRS--VT 190 Gloeocapsa...
jgi:Veis_3517      89 THHHMNPAIIAKYRKVD-WYFAAFKNIELQVIYRLKPDHMESFYARWEKKWHDDGGKDINNPKIPLAHVMEYGEIIW 164 Verminephroba...
pacbio:K649_09665 153 THHHLNPSILDKYRRVR-WIFAVYRNIELQEIYCLEPQQLERFFSDWERKWRAQGGKDINNPKIPLRYVQREGRLIY 228 Meiothermus r...
WP_015175055      189 THHHLNEIILEKYRRVEaWYIGLYEGITLKEIYKLTPEMLEPKFKEWEEKVR-LRNEPLNNPKIPLKLVKK-GQLVy 263 Oscillatoria ...
jgi:Glo7428_2601  191 THHHLNLDILAKYRAVKaWYIAVYEGIVLKAIYRVAPTSLESKFSYWESRIF-EGMKSINNPKIPLALIEKEGKLVY 266 Gloeocapsa sp...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap