1O9V


Conserved Protein Domain Family
Fim-adh_lectin

?
pfam09222: Fim-adh_lectin 
Click on image for an interactive view with Cn3D
Fimbrial adhesin F17-AG, lectin domain
Members of this family are carbohydrate-specific lectin domains found in bacterial fimbrial adhesins. They adopt a compact, elongated structure consisting of a beta-sandwich with two major sheets: one consisting of five long strands in mixed orientations, and a front sheet with four antiparallel strands, forming an immunoglobin-like fold.
Statistics
?
PSSM-Id: 370370
View PSSM: pfam09222
Aligned: 3 rows
Threshold Bit Score: 312.796
Threshold Setting Gi: 502379421
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1O9V_A         2 VSFIGSTENDVGPSLGSYSRTHAMDNLPFVYDTRNKIGYQNANVWHISKGFCVGLDGKVDLPVVGSLDGQSIYGLTEEVG 81 
WP_012775842  24 VSFIGSTENDVGPSQGSYSSTHAMDNLPFVYNTGYNIGYQNANVWRISGGFCVGLDGKVDLPVVGSLDGQSIYGLTEEVG 103 Escherichia coli
Q47199        24 VSFIGSTENDVGPSPGSYSRTHAMDNLPFVYNTGNNIGYQNANVWRISKGFCVGLDGKVDLPVVGSLDGQSIYGLTEEVG 103 Escherichia coli
1O9V_A        82 LLIWMGDTKYSRGTAMSGNSWENVFSGWCVGaNTASTQGLSVRVTPVILKRNSSARYSVQKTSIGSIRMRPYNGSSAGSV 161
WP_012775842 104 LLIWMGDTNYSRGTAMSGNSWENVFSGWCVG-NYVSTQGLSVHVRPVILKRNSSAQYSVQKTSIGSIRMRPYNGSSAGSV 182 Escherichia coli
Q47199       104 LLIWMGDTNYSRGTAMSGNSWENVFSGWCVGaNTASTQGLSVRVTPVILKRNSSARYSVQKTSIGSIRMRPYNGSSAGSV 183 Escherichia coli
1O9V_A       162 QTTVNFSLNPF 172
WP_012775842 183 QTTVNFSLNPF 193 Escherichia coli
Q47199       184 QTTVNFSLNPF 194 Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap