Conserved Protein Domain Family
EcoRII-N

?
pfam09217: EcoRII-N 
Restriction endonuclease EcoRII, N-terminal
The N-terminal effector-binding domain of the Restriction Endonuclease EcoRII has a DNA recognition fold, allowing for binding to 5'-CCWGG sequences. It assumes a structure composed of an eight-stranded beta-sheet with the strands in the order of b2, b5, b4, b3, b7, b6, b1 and b8. They are mostly antiparallel to each other except that b3 is parallel to b7. Alternatively, it may also be viewed as consisting of two mini beta-sheets of four antiparallel beta-strands, sheet I from beta-strands b2, b5, b4, b3 and sheet II from strands b7, b6, b1, b8, folded into an open mixed beta-barrel with a novel topology. Sheet I has a simple Greek key motif while sheet II does not.
Statistics
?
PSSM-Id: 401237
View PSSM: pfam09217
Aligned: 6 rows
Threshold Bit Score: 200.788
Threshold Setting Gi: 81784547
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
KFD03019         15 EWVIYMKRLSANDTGATGGHQVGIYIPKITRDTLFPSINRVDCDNPSIPLSAKIVSHDIEEQTVNAIYYNSKLAKqqkKG 94  Rahnella aqu...
WP_015870831     15 NAYVYIKRLSANDTGATGAHQVGTYMQHSAAEYLFPSINKTDECNPSLMITARTSSHSYPENQVRVIYYNNKFFG---KT 91  Edwardsiella...
wugsc:CKO_03469  16 DTYMFIKRLSANDTGATGGHQVGIYIPSGIVEHLFPSINHTRDLNPSVMLNAHTSSHNCPDSEARAIYYNGRFFG---KT 92  Citrobacter ...
Q9JZ51           29 SIAVYCRYIRPNDVGTTGSHQSGFYIQKHFSDDLFDVVCQ-KGTNKTISIKINWQDGSVTNSNFK--YYGQ-------GT 98  Neisseria me...
WP_014961880     17 ETLWFAKRLSANDTLANNAHQAGPYIPKNILFTLFPSLDRPEDKNPEVRFRLQIDSHQGERREIRAVWYNNRRRG---KT 93  Leptospirill...
WP_011930843     17 GAVWFAKRLAANDTLATGAHGAGPYIPKEFLFSVFPDLNHPEEENPDCWFDLYIDSHA-DRRRIRAIWYNNRLRG---GT 92  Acidiphilium...
KFD03019         95 RNESRITSWGGKkSPIQDPENTGSLLILAFKKQTEl-ADCMYLEAWICRSIEEEDLLETITGE--ILPGISV 163 Rahnella aquatilis C...
WP_015870831     92 RNERRITRWGGG-SPLQDTENTGALALLVFDSSLGgkSDCQSVDVWVCRDADEEDIVEASIGE--ILPGDLI 160 Edwardsiella ictaluri
wugsc:CKO_03469  93 RNEKRITRWGGGkNPLQDPENTGALALLAFDHHQG--SDSQFVDIWVCHNAEEEDIVESSLGE--IVPGSLV 160 Citrobacter koseri A...
Q9JZ51           99 RNEARITGFGKNfEFLSD-KYSGSLLVLCRACYKD-----LLFHAFVL--SSDEDI-EIFIAEtnILPGSLY 161 Neisseria meningitid...
WP_014961880     94 RDEARITGFGGRsSPFLDPENTGALMLLVVPPGDN--TQTSICRAWVCRNPSEEDLLEDLIGP--VEPGKGF 161 Leptospirillum ferri...
WP_011930843     93 RNEARLTNFGGGrSALLDPDSTGALAVFAFLPHGP--GRQMECHVWVCDQGAEADLLEERIGP--VEPKAPV 160 Acidiphilium cryptum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap