1N7U,1N7U


Conserved Protein Domain Family
Prd1-P2

?
pfam09214: Prd1-P2 
Click on image for an interactive view with Cn3D
Bacteriophage Prd1, adsorption protein P2
Members of this family form a set of bacteriophage adsorption proteins, composed mainly of beta-strands whose complicated topology forms an elongated seahorse-shaped molecule with a distinct head, containing a pseudo-beta propeller structure with approximate 6-fold symmetry, and tail. They are required for the attachment of the phage to the host conjugative DNA transfer complex. This is a poorly understood large transmembrane complex of unknown architecture, with at least 11 different proteins.
Statistics
?
PSSM-Id: 401234
View PSSM: pfam09214
Aligned: 2 rows
Threshold Bit Score: 1161.03
Threshold Setting Gi: 30749570
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1N7U_A   1 ANFNVPKLGVFPVAAVFDIDNVPEDSSATGSRWLPSIYQGGNYWGGGPQALHAQVSNFDSSNRLPYNPRTENNPAGNCAF 80  Enterobacteria phage ...
1N7U_A   1 ANFNVPKLGVFPVAAVFDIDNVPEDSSATGSRWLPSIYQGGNYWGGGPQALHAQVSNFDSSNRLPYNPRTENNPAGNCAF 80  Enterobacteria phage ...
1N7U_A  81 AFNPFGQYISNISSAQSVHRRIYGIDLNDEPLFSPNAASITNGGNPTMSQDTGYHNIGPINTAYKAEIFRPVNPLPMSDT 160 Enterobacteria phage ...
1N7U_A  81 AFNPFGQYISNISSAQSVHRRIYGIDLNDEPLFSPNAASITNGGNPTMSQDTGYHNIGPINTAYKAEIFRPVNPLPMSDT 160 Enterobacteria phage ...
1N7U_A 161 APDPETLEPGQTEPLIKSDGVYSNSGIASFIFDRPVTEPNPNWPPLPPPVIPIIYPTPALGIGAAAAYGFGYQVTVYRWE 240 Enterobacteria phage ...
1N7U_A 161 APDPETLEPGQTEPLIKSDGVYSNSGIASFIFDRPVTEPNPNWPPLPPPVIPIIYPTPALGIGAAAAYGFGYQVTVYRWE 240 Enterobacteria phage ...
1N7U_A 241 EIPVEFIADPETCPAQPTTDKVIIRTTDLNPEGSPCAYEAGIILVRQTSNPMNAVAGRLVPYVEDIAVDIFLTGKFFTLN 320 Enterobacteria phage ...
1N7U_A 241 EIPVEFIADPETCPAQPTTDKVIIRTTDLNPEGSPCAYEAGIILVRQTSNPMNAVAGRLVPYVEDIAVDIFLTGKFFTLN 320 Enterobacteria phage ...
1N7U_A 321 PPLRITNNYFADDEVKENTVTIGNYTTTLSSAYYAVYKTDGYGGATCFIASGGAGISALVQLQDNSVLDVLYYSLPLSLG 400 Enterobacteria phage ...
1N7U_A 321 PPLRITNNYFADDEVKENTVTIGNYTTTLSSAYYAVYKTDGYGGATCFIASGGAGISALVQLQDNSVLDVLYYSLPLSLG 400 Enterobacteria phage ...
1N7U_A 401 GSKAAIDEWVANNCGLFPMSGGLDKTTLLEIPRRQLEAINPQDGPGQYDLFILDDSGAYASFSSFIGYPEAAYYVAGAAT 480 Enterobacteria phage ...
1N7U_A 401 GSKAAIDEWVANNCGLFPMSGGLDKTTLLEIPRRQLEAINPQDGPGQYDLFILDDSGAYASFSSFIGYPEAAYYVAGAAT 480 Enterobacteria phage ...
1N7U_A 481 FMDVENPDEIIFILRNGAGWYACEIGDALKIADDEFDSVDYFAYRGGVMFIGSARYTEGGDPLPIKYRAIIPGL 554 Enterobacteria phage PRD1
1N7U_A 481 FMDVENPDEIIFILRNGAGWYACEIGDALKIADDEFDSVDYFAYRGGVMFIGSARYTEGGDPLPIKYRAIIPGL 554 Enterobacteria phage PRD1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap