Conserved Protein Domain Family
CBM27

?
pfam09212: CBM27 
Carbohydrate binding module 27
Members of this family are carbohydrate binding modules that bind to beta-1, 4-manno-oligosaccharides, carob galactomannan, and konjac glucomannan, but not to cellulose (insoluble and soluble) or soluble birchwood xylan. They adopt a beta sandwich structure comprising 13 beta strands with a single, small alpha-helix and a single metal atom.
Statistics
?
PSSM-Id: 117765
View PSSM: pfam09212
Aligned: 2 rows
Threshold Bit Score: 316.151
Threshold Setting Gi: 75424822
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_015919815 495 AQYVLAEEV--DFSRPEEVKNWWNSGTWQAEFKTPDIEwngEVGNGALQMNVVLPGKGDWEEVRV-VRKFDQLPVCEILE 571 Thermotoga neap...
Q9ZI87       525 IQNASAYEIikQFSFDSDMNNVYADGTWQANFGIPAIS---TPKTRCLRVNVDLPGNADWEEVKVkISPISELSETSRIS 601 Geobacillus ste...
WP_015919815 572 YDIYIPDVEgLTGRLRPYAVLNPGWVKIGLDMNNTSIDSGELVSFDGKKYRKFHVRIEFDKTPGVNELHIGVVGDHLEYD 651 Thermotoga neap...
Q9ZI87       602 FDLLLPRVD-VNGALRPYIALNPGWIKIGVDQYHVNVNDLTTVTIHNQQYKLLHVNVEFNAMPNVNELFLNIVGNKLAYK 680 Geobacillus ste...
WP_015919815 652 GPIFIDNVRLYKK 664 Thermotoga neapolitana
Q9ZI87       681 GPIYIDNVTLFKK 693 Geobacillus stearothermophilus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap