5TXI


Conserved Protein Domain Family
DUF1958

?
pfam09211: DUF1958 
Click on image for an interactive view with Cn3D
Domain of unknown function (DUF1958)
Members of this functionally uncharacterized family are found in prokaryotic penicillin-binding protein 4.
Statistics
?
PSSM-Id: 401233
View PSSM: pfam09211
Aligned: 4 rows
Threshold Bit Score: 100.614
Threshold Setting Gi: 153796695
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5TXI_A       293 YVKILSKGEQRINGKKYYVENDLYDVLPSDFskkDYKLVVEDGKVHADYPREFINKDYGPPTVEVH 358 Staphylococcus aureus
EOT89492     335 RKKLLDKGPQTIDHKKVTLANDLYGVVPKGS---QPTFKLVAGQVQVDTPLTLLNSTVQAPKVAYQ 397 Enterococcus faecalis V583
WP_012656071 318 YKKVLAKGVHTINGQELYVHSDLYDIVKKDV---KGSFQFKDGKLSYHYKRTFVSNEYHAPTVKAE 380 Terrabacteria group
EDN79115      32 YKKVLSKGVHTIDGKKVEISKDLWDCVPKGK---EAPLTIKDGKVLVDLEREYL-PGFQAPAVSCK 93  [Ruminococcus] gnavus ATCC 29149
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap