3V05,5D3I,3URY,4O1N,3R2T


Conserved Protein Domain Family
SSL_OB

?
pfam09199: SSL_OB 
Click on image for an interactive view with Cn3D
Staphylococcal superantigen-like OB-fold domain
This OB-fold domain folds into a five-stranded beta-barrel. Members of this family are found in various staphylococcal toxins described as staphylococcal superantigen-like (SSL) proteins that are related to the staphylococcal enterotoxins (SEs) or superantigens. These SSL proteins of which 11 have so far been characterized have a typical SE tertiary structure consisting of a distinct oligonucleotide/oligosaccharide binding (OB-fold), this domain, linked to a beta-grasp domain, family Stap_Strp_tox_C, pfam02876. SSLs do not bind to T-cell receptors or major histocompatibility complex class II molecules and do not stimulate T cells. SSLs target components of innate immunity, such as complement, Fc receptors, and myeloid cells 2,3,4,5,6,7,8]. SSL protein 7 (SSL7) is the best characterized of the SSLs and binds complement factor C5 and IgA with high affinity and inhibits the end stage of complement activation and IgA binding to FcalphaR.
Statistics
?
PSSM-Id: 401224
View PSSM: pfam09199
Aligned: 11 rows
Threshold Bit Score: 96.6061
Threshold Setting Gi: 122540733
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3V05_B  28 KSLKYYYSKPSIELKNLDGLYRQK-VTDKGVYVWKDRKDYFVGLLGKDIEKYPQGEHDKQDAFLVIEEETVNGRQYSIGG 106 Staphylococcus aureus...
Q2G0X8  42 KKLKAYYNQPSIEYKNVTGYISFIqPSIKFMNIIDGNSVNNIALIGKDKQHYHTGVHRNLNIFYVNEDKRFEGAKYSIGG 121 Staphylococcus aureus...
5D3I_B   8 EDLRAYYTKPSFEFEKQFGFMLKPwTTVRFMNVIPNRFIYKIALVGKDEKKYKDGPYDNIDVFIVLEDNKYQLKKYSVGG 87  Staphylococcus aureus...
3URY_A   6 KDLRAYYTKPSLEFKNEIGIILKKwTTIRFMNVVPDYFIYKIALVGKDDKKYGEGVHRNVDVFVVLEENNYNLEKYSVGG 85  Staphylococcus aureus...
4O1N_F  25 SELKHYYNKPILERKNVTGFKYTD-EGKHYLEVTVGQQHSRITLLGSDKDKFKDGENSNIDVFILREGDSRQATNYSIGG 103 Staphylococcus aureus...
Q2G0X4  41 QDLSEYYNRPFFEYTNQSGYKEEG-K----VTFTPNYQLIDVTLTGNEKQNFGEDIS-NVDIFVVRENSDRSGNTASIGG 114 Staphylococcus aureus...
Q2G2X7  43 eALYRYYTGKTMEMKNISALK----HGKNNLRFKFRGIKIQVLLPGNDKSKFQQRSYEGLDVFFVQEKRDKHDIFYTVGG 118 Staphylococcus aureus...
Q2G2Y0  44 KDLHRYYSSESFEFSNISGKVENY-NGSNVVRFNQENQNHQLFLLGKDKEKYKEGIE-GKDVFVVKELIDPNGRLSTVGG 121 Staphylococcus aureus...
Q2G2X8  44 nMLHQYYSEESFEPTNISVKSEDY-YGSNVLNFKQRNKAFKVFLLGDDKNKYKEKTH-GLDVFAVPELIDIKGGIYSVGG 121 Staphylococcus aureus...
3R2T_B  61 NKLHQYYSGPSYELTNVSGQSQGY-YDSNVLLFNQQNQKFQVFLLGKDENKYKEKTH-GLDVFAVPELVDLDGRIFSVSG 138 Staphylococcus aureus...
Q2G1S6  45 fDLRDYYSGASKELKNVTGYRYSK-GGKHYLIFDKNRKFTRVQIFGKDIERFKARKNPGLDIFVVKEAENRNGTVFSYGG 123 Staphylococcus aureus...
3V05_B 107 LSKTN 111 Staphylococcus aureus subsp. aureus NCTC 8325
Q2G0X8 122 ITSAN 126 Staphylococcus aureus subsp. aureus NCTC 8325
5D3I_B  88 ITKTN 92  Staphylococcus aureus subsp. aureus NCTC 8325
3URY_A  86 ITKSN 90  Staphylococcus aureus subsp. aureus NCTC 8325
4O1N_F 104 VTKSN 108 Staphylococcus aureus subsp. aureus NCTC 8325
Q2G0X4 115 ITKTN 119 Staphylococcus aureus subsp. aureus NCTC 8325
Q2G2X7 119 VIQNN 123 Staphylococcus aureus subsp. aureus NCTC 8325
Q2G2Y0 122 VTKKN 126 Staphylococcus aureus subsp. aureus NCTC 8325
Q2G2X8 122 ITKKN 126 Staphylococcus aureus subsp. aureus NCTC 8325
3R2T_B 139 VTKKN 143 Staphylococcus aureus subsp. aureus NCTC 8325
Q2G1S6 124 VTKKN 128 Staphylococcus aureus subsp. aureus NCTC 8325
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap