2Q3T


Conserved Protein Domain Family
RdDM_RDM1

?
pfam09187: RdDM_RDM1 
Click on image for an interactive view with Cn3D
RNA-directed DNA methylation 1
This family of plant proteins includes RDM1 from Arabidopsis, which is a component of the RNA-directed DNA methylation (RdDM) effector complex and may have a role in linking siRNA production with pre-existing or de novo cytosine methylation. As part of the DDR complex with two other RdDM components, it has been shown to facilitate association of PolV to chromatin.
Statistics
?
PSSM-Id: 401218
View PSSM: pfam09187
Aligned: 11 rows
Threshold Bit Score: 221.553
Threshold Setting Gi: 255547486
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2Q3T_A        38 LLRRAEMYQDYMKQVPIPTNR-GSLIPFTSWVGLSISMKQLYGQPLHYLTNVLLQRWDQSRFGTDSEEQRLDSIIHPTKA 116 thale cress
KRH77826      42 LIRRAEMYQDYMKQIPIPNHR-GTMIPFTSWMGLGRSMKQIYGQPLHYLTNILLKQWDQLRIGSEDEYKPLDNIVHPHKA 120 soybean
XP_002311260  75 MMRKAEIYQEYMKQIPIPSSTcGLPISYMTWQELARTIKQVYGQPLHYLTNKLLKQWDQLRIGTKDESKPLDNIIDPNRA 154 black cottonwood
XP_009145304  46 LLMRAEAYQGYMKELPLPTSR-GSLIPFTSWVGLGMSIKELYGQPLHYLTNVLLQRWDQARLGSDSEVQSLDLIIHPLKA 124 field mustard
XP_015573460  56 LIRRAEMYQDYMRQLPIPVHH-GSVIPFSSWVGLGKSIKQLYGQPLHYLTNILLKQWDQLRFDNGDEQKSLDIVIHPCKA 134 castor bean
XP_002311634  56 LIRRAEMYQDYMRHIPIPVQR-GSAIPFSSWAGLGKSIKQLYQQPLHYLTNILLNKWDQQRIGSEDEHTPLDIMIHPCKA 134 black cottonwood
ERN01570      52 LMRRAKMYEEYMRDIPIPSHR-KAVIPFNSWQGLAKSMKQLYGQPLHYLTNVLLKEWDHSNDGVNHDGRLLDEIFHPVRA 130 Amborella trich...
Q67IW5        51 LIRKAEMYQEYMKHIPVPAHR-GSVIPCTTWLGLGRSVKQLYKQPLHYLTNVLLKQWDQQRVGSDDEHRPLDAIIHPVKA 129 Japanese rice
XP_002514800  73 IRKAAEKYQQGMKLIPIPPSH-ASPILFITWQGLARSIKQKYEQPLHYLTMKLLKEWDQSRLGSVEERKPLEDIIDPVKA 151 castor bean
XP_019075614  55 VIRRAEMYQEYMKQIPIPARR-GSLIPFDTWMGLAKSIKQLYGQPLHYLTNILVKQWDQLRIGSKDENRSLDSIIHPSKA 133 wine grape
XP_015169155 169 ILRRARMYQEYMKVVPLPTQR-GFVIPLTSWVGLAASMKELYGQPLHYLTNVHMKKLDSMRFGSDNEDVPLDTIIDPSKA 247 potato
2Q3T_A       117 EATIWLVEEIHRLTPSHLHMALLWRSDPMYHSFIDPIFP 155 thale cress
KRH77826     121 EATIWLIEEIHRQTSSHFHLASLWKVDPMYNGFVDSIFP 159 soybean
XP_002311260 155 VATIWGMEEFHRQCSSHQHLARLWLSDPLQHDSLDKTVP 193 black cottonwood
XP_009145304 125 EATIWLVEEIHRLTSSHLQIAELWGSDPMYHMLIDPIIP 163 field mustard
XP_015573460 135 EASVWLVEEIHRCTSSPHYVAKLWLLDPMHHAFVDSIFP 173 castor bean
XP_002311634 135 EATIWLVEEVHRRTSSHHHVAKIWQSDPMHHAFVDSIFP 173 black cottonwood
ERN01570     131 EAIVWAVEEIHRLTSSHHHLAKLWAEVPLHQAYVDAIHP 169 Amborella trichopoda
Q67IW5       130 EALIWITEEVHRLTTSSQHLASLWASAPMYHAYIDPVFP 168 Japanese rice
XP_002514800 152 EATIWVVEHFHRQCSSPGHLSKLWLSDPTYQDFIDlnpm 190 castor bean
XP_019075614 134 EASIWLIEEVHRQTTSPHHMAKLWLSDPMHYAFVDSIFP 172 wine grape
XP_015169155 248 EATIWLIEEVHRSTSSHHYIARLWLADPMYHIHVDAIFP 286 potato
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap