Conserved Protein Domain Family
DUF1944

?
pfam09175: DUF1944 
Domain of unknown function (DUF1944)
Members of this family adopt a structure consisting of several large open beta-sheets. Their exact function has not, as yet, been determined.
Statistics
?
PSSM-Id: 401207
View PSSM: pfam09175
Aligned: 31 rows
Threshold Bit Score: 194.753
Threshold Setting Gi: 1110901992
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_015211181 1082 PTVTFQAVVVRSNAKQEGYVATACISHTTTKDKMKLLISDVNKESKWKMSTDAVMdMDPLRTKVQVRWGEDHWKYKFAGE 1161 spotted gar
XP_015211994 1290 PVLAILARAVRTDGKAQGYQVAFYHHPRSSQPRAQVIVAAIQEKDNWKMCGDGMM-LSQHKAMAKMSWGEDCQQYLAVVK 1368 spotted gar
XP_015211416 1258 PLFAVVARARRSDGLQQGYQLAVYADTTLSKPRVQALAIEINSKDKWQVCADAEL-HNDYKALALVRWGQECREYKVAVK 1336 spotted gar
XP_014342633 1302 PVLAVIACAIRSDGKRQGYQIATYTDASLPRPKVQILVMELEAGSRWRICADAAV-LSPYKAKAELKWGQECQDYKVALK 1380 coelacanth
XP_005993912 1370 PVLAIVTRAVRSDGKQQGYQIAAYANFRSSKPRVQVLAMELAKSDRWRVRVDGIL-LSPHKAMGIIKWGEEGKNYKVVVK 1448 coelacanth
XP_016850380  534 risdIRVRILCRDNKPRGFDVVVFKTPNW----LRMTVTNITQPSKPFICWDSGM-VNPYKVKSSLKAGRDCKEYEVTTE 608  green anole
XP_002186993 1375 PVLAAFLHGIRDDKKIGGLQLVVYADTDSIRPRMQVFVSNLTDSSKWKLCADASV-LNDHKATAYLKWGRNCQDYKVSSE 1453 zebra finch
XP_005050329 1253 PVLAAVLCAIHRNKQQTGLQLVLYTDTQPKRWRMQMFGSSITGPSRWKLCADASV-INYRKVSGSLKWGKDCQDYQIATQ 1331 Collared flyc...
XP_028919417 1558 PAVAAVFRAFRSDKKQAGYQFMMYTDTHSSRPRMQLFFSSISATSKWKFCADALV-VNTHKAAASLKWGQNCRQYKVATK 1636 platypus
XP_016850400 1136 sglVATLNTIQNNKKLKICQVVLESDLHSSRPTVHIFVSDLQGYKRMKFCGDVSI-LSSQNAEGYLKWGKDCRDYKISTK 1214 green anole
XP_015211181 1162 ARYVEKcGSYPSVKAKLQWEKVPRFMKTFGEKVHEYLPGIALLLQCYQKQQRNPSHQVSVTLMPTSSSAMfDVILKTPGL 1241 spotted gar
XP_015211994 1369 AETGRL-AHNPAVQLKIKWRKIAGIVKHVSKILFDYVPGVSYMAGFSEDRRNNPSKQIKMIFAATSSRTI-DAVIKMPRF 1446 spotted gar
XP_015211416 1337 AATGRI-ATHPALQVKAKWWKIPRAMKYAGETMAEYVPGAALMLGFSQKWHKHTSKQLALYIAMSSPRTV-DLFIKTPRM 1414 spotted gar
XP_014342633 1381 TEIGRF-AIYPAVQIKMSWDNVPRPIKDRVKAFDEYVPGAAYMLGFTEKWQKNPSHQLVVILTSTSPRII-DIVIRAAPL 1458 coelacanth
XP_005993912 1449 AQTGQF-AAHPAVQVKVDWTDVPRTVKETVRAADKYLPGAAYLAGFSEKWRRNPSHQVAVILASASSRTI-DIVVKLPQM 1526 coelacanth
XP_016850380  609 VETGSL-AGHPALRWKLEYPRIPSSLSTILEPYYERTPGVAYMLGLSHVIQRNSAREVSVVLALITRLNY-AMVMRIPGN 686  green anole
XP_002186993 1454 LVTGQF-ADHPAVQVKLEWPKVPSSVRSVAEWFYKFVPGAAFMLGFSEKTDKNPSRQARVIVALTSPRTC-DVVIKLPDV 1531 zebra finch
XP_005050329 1332 IATGQF-AVYPAMQMKLEWLKVPSIIRTTARWVYSFLPGAAYMLGFSQRQQPGPSHQATLVMALTSPRTC-DVVFKMPEL 1409 Collared flyc...
XP_028919417 1637 VVTGRF-ADHPALQVKAEWPKVSSQIRKAANWFYPFFPGLAYMFGFYGKEWKNPSRQATFVVSATSARTS-AVVIKLPDF 1714 platypus
XP_016850400 1215 IAYGQL-AGHPAMQIKLEWPQIPSRIEEVGRELSMLIPGTAYMLGFPEVEQKNPSQQASVILALTSSRTC-SLVAKLPHV 1292 green anole
XP_015211181 1242 TVYGYTIPLP 1251 spotted gar
XP_015211994 1447 TVYKRAVHVP 1456 spotted gar
XP_015211416 1415 ALCKQAVPVP 1424 spotted gar
XP_014342633 1459 TLYYQGFEIP 1468 coelacanth
XP_005993912 1527 TLYRQAIPVP 1536 coelacanth
XP_016850380  687 TLYKEDLMLP 696  green anole
XP_002186993 1532 TLYEKAMRLP 1541 zebra finch
XP_005050329 1410 TIYDTAISLP 1419 Collared flycatcher
XP_028919417 1715 TIYDRAIWLP 1724 platypus
XP_016850400 1293 MIYGTNIKIP 1302 green anole
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap