4PII,1XQP


Conserved Protein Domain Family
AGOG

?
pfam09171: AGOG 
Click on image for an interactive view with Cn3D
N-glycosylase/DNA lyase
This domain is predominantly found in the Archaeal protein N-glycosylase/DNA lyase.
Statistics
?
PSSM-Id: 401203
View PSSM: pfam09171
Aligned: 15 rows
Threshold Bit Score: 253.865
Threshold Setting Gi: 150421518
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4PII_A          15 IIKGigIEGAKEVEEKvDRQFYALQYLFRHQDP---------------EMFikLVIANSLVSYQLTGRGEDWWWEFARYF 79  Pyrococcus fu...
jgi:Igag_1459   16 TLRSigIIGAKYFESL-DPQMDIARELVSKCSNn--------------ALY--LLALNSLVSYSLTMRGEIFWKEFSKYV 78  Ignisphaera a...
Q8TXW8           6 FLRKvtLREICVIEEYvDVQYRAIEALMDTLPS---------------TDLvrLTVANALVSYQLSSSGEDWWREFSSYF 70  Methanopyrus ...
WP_013180621    25 LLKNfdINTARKFEEEiDIQYKMLTNLYNSLIEqveeemqdfyedlavEVFvkLVIMNSLISYQLSGTGEAWWTEFSQYW 104 Methanococcus...
jgi:Smar_0731   25 LISK--IRDFIDLLEKnDPQYHAVSELVRHYGK---------------ELTsiIVVANALISYQLSSRGEEYWSALSKWF 87  Staphylotherm...
WP_011752491    15 IFRGsiRELSLLFVER-DPQFLAVRKILEKAGFpe------------gGFYvaGV---ALVSYMLSKRGEDHWLEAAELF 78  Thermofilum p...
jgi:Cmaq_0843   14 VLRElsLSDVLAFEER-DPQFIVVKELCTALNNp--------------GLVavLVAMNSIVSYMLTGRGERHWSYFSEYF 78  Caldivirga ma...
1XQP_A          13 TLRRlgIEEVLKLERR-DPQYRAVCNVVKRHGE---------------TVGsrLAMLNALISYRLTGKGEEHWEYFGKYF 76  Pyrobaculum a...
CCC82212         8 LLRRvgLSRILAIEKR-DPQYLAVCRVCENRGA---------------DETarLVMLNALISYRLTGKGEEHWMYFADFF 71  Thermoproteus...
jgi:Calag_0866  17 SIKNfgLDNVLILEEKlDPQFDYIQKLKEKVGKny------------aTIYslLV---SLISYKLTMKGEDWWKCFSEYL 81  Caldisphaera ...
4PII_A          80 --------SGREVDS----------IWKAYGEFlpkskNNRRLIEAKLNRIRKVegflstLTLKDLEGYY-KN--MKMLW 138 Pyrococcus fu...
jgi:Igag_1459   79 llrcreieSFHDIVK----------IVKEFTMI-----YNRYLLNQKIRRLDRI------MHCKDIVNYI-NNvkLVELR 136 Ignisphaera a...
Q8TXW8          71 --------RERRPRD----------IVREYARFlprsrGNRRLIRQKLRRLHRAkafleeLSWQDAKSYY-RD--MNRLR 129 Methanopyrus ...
WP_013180621   105 --------SNKENKIlekysgnkelLLEEFINFlknskGNRRFHITKIKRLEKIyeflkdLTFEEIKYYY-EN--MEELR 173 Methanococcus...
jgi:Smar_0731   88 idr---reKIKDINN----------IIENHIMFlkitnYNRMGLKHKIKRLQVFyn--ssLAKNLVNSPLkFCnqLDKLV 152 Staphylotherm...
WP_011752491    79 d-----------------------gTPGALYRFveeaeSLRRFREHRVKRIKRYvasrekVL--SLLSEVpVN--LERFA 131 Thermofilum p...
jgi:Cmaq_0843   79 --------SHNKPSD----------LCRDFKAYvvkspYLARGREVKVDRIDRFcraklhERLMGLTN-------LNEAW 133 Caldivirga ma...
1XQP_A          77 --------SQLEVID----------LCRDFLKYietspFLKIGVEARKKRALKAcdyvpnLED------------LGLTL 126 Pyrobaculum a...
CCC82212        72 --------STRRNID----------ICKEFFEYlskspYLILNRNARMSRVRKAcgikpdIDD------------LIKTW 121 Thermoproteus...
jgi:Calag_0866  82 sakdipknFEESINN----------VI----NFindckGSIIGRAAKIKRIEKVvkgsrdILLEILERPEvVLekPNKIL 147 Caldisphaera ...
4PII_A         139 KALIKIMGSREDSKTIVFTVKMFGYASRiAFSRfipYPMEIPIPEDLRIKSVTS----------------KLTQ------ 196 Pyrococcus fu...
jgi:Igag_1459  137 NYIAKCLDSDPDSKTIVFSIKMIYYGLR-ALGYdytLPFDIPIPVDRRVARISStsgvieceslkpcnieYVLHy----p 211 Ignisphaera a...
Q8TXW8         130 LDLARVLNADPESKTIVFTVKMFGYALRaITGRfrpYPFEIPIPVDARIERITR----------------RITN------ 187 Methanopyrus ...
WP_013180621   174 NIVSKNLDTQKSAKTVVFSIKMYGYACRiSLKQyiaYPMDIEIPLDSRIEKYTKkildinlknpkkiqgvKLTD------ 247 Methanococcus...
jgi:Smar_0731  153 YMISKILKTDPTAKTVVFAGKMYYYFCLtCKAE---ISGEIPIPVDRRNSFLAItscivgcknntstcvkELMTpk--nr 227 Staphylotherm...
WP_011752491   132 STVARIVGANPEDKTVVFASKMLLYACI-AANKeytGGERLPIPVDYRVSLVTLtsgiakgwsclddlraHASNlrakhk 210 Thermofilum p...
jgi:Cmaq_0843  134 SLLAGGLHSPINSKTIVFAVKMLYYAYR-ACGInvkPPEDLPIPVDYRIATLTKcsglinaeakvlaakqNLVQ------ 206 Caldivirga ma...
1XQP_A         127 RQLSHIVGARREQKTLVFTIKILNYAYMcSRGVnrvLPFDIPIPVDYRVARLTWcaglidfppeealrryEAVQ------ 200 Pyrobaculum a...
CCC82212       122 NKLALTLDVDPNSKTVVFALKMLNYVYMcCRGVdrpVPFEIPIPVDYRVARMTSclgliamtpeeamrryREIQ------ 195 Thermoproteus...
jgi:Calag_0866 148 EEIAKSLNSKEWKKTITFSIKMSYYAIK-NRGElrpLNIVIPMPIDVRISCISYtsgiie-----snsykEILKk----p 217 Caldisphaera ...
4PII_A         197 EKPTKFWMKIGQESGVPPLHIDSLIWpLLGNADLTPLDIELR 238 Pyrococcus furiosus DSM 3638
jgi:Igag_1459  212 KIIIKAWNEIGKTSSIPPLHIDAIIW-YFGGFSNATNRNEIL 252 Ignisphaera aggregans DSM 17230
Q8TXW8         188 DDPQLYWDSIARRTGIPPLHLDSILW--VGTSR----DPEVK 223 Methanopyrus kandleri AV19
WP_013180621   248 KYMLEFWKEVSRTTEIPPLHIDSILWtALGKSF------DIE 283 Methanococcus voltae
jgi:Smar_0731  228 EIVIEAWKIVSEKANIPLYKLDSFTWlLTGMIRQLKEPIKIY 269 Staphylothermus marinus F1
WP_011752491   211 EEVKAAWSLVGRQAEIPPILLDAPVW--LVGGCIDRGDFEVK 250 Thermofilum pendens
jgi:Cmaq_0843  207 ----ETWGRVAELSGIPQVNLDALLW--VIGGALIYSNFNVN 242 Caldivirga maquilingensis IC-167
1XQP_A         201 ----KIWDAVARETGIPPLHLDTLLW--LAGRAVLYGE-NLH 235 Pyrobaculum aerophilum
CCC82212       196 ----TVWRRIAEASGIPPLHIDTLLW--LAARAVLYSD-TEN 230 Thermoproteus tenax Kra 1
jgi:Calag_0866 218 KIAIEAWDKVSQLSNIPQIHLDSLLW-IIGRNSMELSLDEAK 258 Caldisphaera lagunensis DSM 15908
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap