Conserved Protein Domain Family
Biliv-reduc_cat

?
pfam09166: Biliv-reduc_cat 
Biliverdin reductase, catalytic
Members of this family adopt a structure consisting of four alpha helices and six beta sheets, in an alpha-beta-alpha-alpha-alpha-beta-beta-beta-beta-beta arrangement. They contain a catalytic active site, capable of reducing the gamma-methene bridge of the open tetrapyrrole, biliverdin IX alpha, to bilirubin with the concomitant oxidation of a NADH or NADPH cofactor.
Statistics
?
PSSM-Id: 401198
View PSSM: pfam09166
Aligned: 13 rows
Threshold Bit Score: 218.041
Threshold Setting Gi: 928159566
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_015137100 128 YKQLKKEVAGKDLVKGTLHFTGSVLdETKAGFPAFSGIARLTWLIDLFGDLTITSASREEQKDKNYSRMTVHFQTANKKP 207 chicken
XP_007250759 128 FKQLKKDIAGKQLEEGSLHFTGGPL-KPGFGFPAFSGISRLTWLVDLFGELSVKAATLEEDEDRKYSKMTAHFLTKDQKP 206 Mexican tetra
NP_001070069 128 FKQLKKDISGKTLEEGKLHFTGGPL-KANFGFPSFSGIARLTWLVVLFGELTVTSVDLVEEKENKYMKMTAHLLTQQHKP 206 zebrafish
CAF90802     128 FKALKRELEGKTLQEGTLHFTGGPL-KPTFGFPAFSGVARLTWLVELFGRLSVTAATLEEDPEKNYSKMTATLKTSSDRS 206 spotted green p...
XP_005809267 128 YKQLKKEVEGKTLLEGSLHFAGGAL-KPGFGFLAFSGIARLSWLADLFGELSVSAATFEEDAEQGYSKMTAQLLTSDSKP 206 southern platyfish
XP_003456769 128 YKQLKREVEGKTLQEGTLHFTGGAL-KPGFGFPSFSGIARLTWLVELFGELSVSAATLEEDPANSYSKMTAKLLTSDNRS 206 Nile tilapia
XP_006634403 128 YKQLKKDVTGKNLVEGTLHFTGGPL-QPGFGFIAFSGIARLTWLVDLFGELTVTSANVEEDKEKKYIKMTAHFQTKDKSP 206 spotted gar
XP_003222261 129 YKQLKKEVEGKELVKGTLHFTGGPLdEERSGFPAFSGIARLSWLVDLFGDLTVTSATREEQKEKNYSRMTAHFLTADKRP 208 green anole
XP_005630975 150 FAFLKKEVVGKDLLKGSLLFTAGPLeEERFGFPAFSGISRLTWLVSLFGELSLVSATLEEQKEDQYMKMTVCLETENKRP 229 dog
XP_003763167 126 FAFLKNEVAGKKLLKGTLHFTGGPLeKERFGFLAFSSIARLSWLVSLFGELAVISATMEEQEEKKYLKMTVNLETVNKRP 205 Tasmanian devil
XP_016280043 178 FAFLKNEVAGKELMEGTLHFTGGPLdKGKFGFIAFSAISRLSWLVSLFGELSFISATMEERKEDQYQKMTVHLETVDKRP 257 gray short-tail...
XP_028919389 128 yisLKKEVSGKELVKGTLHFTAGPLdEERFGFPSFSGISRLSWLVDLFGELSLVSATMEEQKDKKYLKMTADLKTADQRP 207 platypus
KAE8597062    34 YKQLKKEVQGKKLVEGVLHFTGGHLdENLSGFPSFSGIARLSWLVDLFGDLIVTSATREEQKELNYSKLTAHFLTAENRP 113 tropical clawed...
XP_015137100 208 LTWIEERGPGMRREKKINFCFTSGCLENFPQAP 240 chicken
XP_007250759 207 LSWIEERGPGMGRTKRINLRFDSCTLTELPAGQ 239 Mexican tetra
NP_001070069 207 LTWIEERGPGLGRAKHVEFRFQDVTITELPAGQ 239 zebrafish
CAF90802     207 LTWIEERGPGFPRAKNIHFRLDGCTLTQIPAAP 239 spotted green pufferfish
XP_005809267 207 LTWIEERQAGLPRTKKINFVFDGFTLTQIPPAP 239 southern platyfish
XP_003456769 207 LTWIEERQPGLPRAKNINFQFDSGTLTQIPPAP 239 Nile tilapia
XP_006634403 207 LTWIEERAPGLGRVKNISFRFDTGVMDCLPVAP 239 spotted gar
XP_003222261 209 LTWIEERAPGMKRDKIINFCFKSGCLERLPDAP 241 green anole
XP_005630975 230 LTWIEEKGPGLKRNRHLSFHFKSGSLENMPNvg 262 dog
XP_003763167 206 LTWIEERGPGLKRERHINFLFESGLLESIPPpt 238 Tasmanian devil
XP_016280043 258 LTWIEERGPELKREHHVNFLFESGRLESLPPpa 290 gray short-tailed opossum
XP_028919389 208 LTWIEEKGPDLKREKHIKFSFTSGCLENLPAAP 240 platypus
KAE8597062   114 LTWVEERAPGMKRDKHIHFSFTTGILDTLPSSS 146 tropical clawed frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap