5D1T,5D1T


Conserved Protein Domain Family
Anthrax-tox_M

?
pfam09156: Anthrax-tox_M 
Click on image for an interactive view with Cn3D
Anthrax toxin lethal factor, middle domain
Members of this family, which are predominantly found in anthrax toxin lethal factor, adopt a structure consisting of a core of antiparallel beta sheets and alpha helices. They form a long deep groove within the protein that anchors the 16-residue N-terminal tail of MAPKK-2 before cleavage. It has been noted that this domain resembles the ADP-ribosylating toxin from Bacillus cereus, but the active site has been modified to augment substrate recognition.
Statistics
?
PSSM-Id: 401191
View PSSM: pfam09156
Aligned: 2 rows
Threshold Bit Score: 560.481
Threshold Setting Gi: 951272870
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5D1T_A   4 LSRYEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKELLKRIQIDSSDFLSTEEKEFLKKLQID 83  Bacillus anthracis
5D1T_A   4 LSRYEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKELLKRIQIDSSDFLSTEEKEFLKKLQID 83  Bacillus anthracis
5D1T_A  84 IRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYDINQRLQDTGGLIDSPSINLDVRKQYKRDIQNIDALLH 163 Bacillus anthracis
5D1T_A  84 IRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYDINQRLQDTGGLIDSPSINLDVRKQYKRDIQNIDALLH 163 Bacillus anthracis
5D1T_A 164 QSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNFKYSISSNYMIVDINERPALDNERLKWRIQ 243 Bacillus anthracis
5D1T_A 164 QSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNFKYSISSNYMIVDINERPALDNERLKWRIQ 243 Bacillus anthracis
5D1T_A 244 LSPDTRAGYLENGKLILQRNIGLEIKDVQIIKQSEKEYIRIDAKVV 289 Bacillus anthracis
5D1T_A 244 LSPDTRAGYLENGKLILQRNIGLEIKDVQIIKQSEKEYIRIDAKVV 289 Bacillus anthracis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap