2XJ9


Conserved Protein Domain Family
MipZ

?
pfam09140: MipZ 
Click on image for an interactive view with Cn3D
ATPase MipZ
MipZ is an ATPase that forms a complex with the chromosome partitioning protein ParB near the chromosomal origin of replication. It is responsible for the temporal and spatial regulation of FtsZ ring formation.
Statistics
?
PSSM-Id: 401181
View PSSM: pfam09140
Aligned: 8 rows
Threshold Bit Score: 412.618
Threshold Setting Gi: 1378072883
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2XJ9_A     5 RVIVVGNEKGGAGKSTIAVHLVTALLYGGAKVAVIDLALRQRTSARFFENRRAWLDNKKIELPEPLAlnlsdndvaLAER 84  Caulobacter vibrioides
AVZ41658   7 YFIVFANEKGGSGKSTTAVHVAVALSAKGLKVAAVDLDTRQRTFARYMENRVESVKRIGMDLPTPET---------KVFD 77  Zymomonas mobilis s...
Q2G320     6 HRIVFANEKGGTGKSTTAVHVAVALAYQGARVATIDLDARQRTMHRYFENRAETMRRREIALPTASF---------DVYG 76  Novosphingobium aro...
Q2N658     7 HRVVFANEKGGTGKSTTAVHVAVALAYKGARVAAIDLDHRQRTMHRYFENRSETEARRGISLPGTRC---------EVYD 77  Erythrobacter litor...
Q2W0K2    29 HVIVVGNEKGGTGKSTISMHLIVSLLDRGLSVGSIDIDARQATLTRYIGNRAARQDRTELSLPIPEHmai------ppTG 102 Magnetospirillum ma...
CAL78289  14 HVVVLGNEKGGSGKSTTALHIAVALLKAGQRVATIDLDCRQQSFTHYINNRSAWARRTGLRLELPTHyciqlgqtlQIDE 93  Bradyrhizobium sp. ...
Q28UF7     3 HIIVLGNEKGGSGKSTTSMHVATALARMGHVVGGLDLDLRQRSFHRYLGNRLATAERKGLDLACPMIlelpdaapeDVPD 82  Jannaschia sp. CCS1
Q3IZ08     3 HIIVVGNEKGGSGKSTTCMHVATALVRLGFRVGALDLDLRQRSFGRYVENRLAFAESSGLSLPMPDYrvlpeveesEVPE 82  Rhodobacter sphaero...
2XJ9_A    85 PEEEQvaGFEAAFARAMAECDFILIDTPGGDSAITRMAHGRADLVVTPMNDSFVDFDMLGTVDPVTLELTKPSLYSLTVW 164 Caulobacter vibrioides
AVZ41658  78 PDSGD--DLNLLLDELSQNYDFVIVDTPGRHSSDIRSALERADSLVTPINDSFVDLDLIGQVDPESYHIKRPSFYAELVW 155 Zymomonas mobilis s...
Q2G320    77 QDSIE--ALDELTERLGQGYDFIVFDTPGRDDPLARHVATRADTLVTPLNDSFVDFDLIGQVDAETFKVRRLSFYAELIW 154 Novosphingobium aro...
Q2N658    78 GEDIG--ELEALAADLSREADFLIFDTPGRDDPLARHAATEADTLVTPLNDSFVDFDLIGQVDAETFKVRRLSFYAELIW 155 Erythrobacter litor...
Q2W0K2   103 DASADcaRLEEVFRDFAARHDVVVIDTPGSDHPMSRLGHSFADTLVTPLNDSLVDLDVLALVEPGSMKIRRPSHYAEMVW 182 Magnetospirillum ma...
CAL78289  94 NENTEfqQFMEAVSAVERSFDFIVIDTPGNDSYLMRLAHSMADTLVTPINDSFLDFDVLGTVDAATYAVTGESHYAEMVR 173 Bradyrhizobium sp. ...
Q28UF7    83 GVNIYdhRLSAAVADQESRCDFIVIDCPGSHTRLSQVAHSLADTLITPLNDSFVDFDLLAKIDPETFALKGPSVYSEMVW 162 Jannaschia sp. CCS1
Q3IZ08    83 GENPLdvRMAKAMAALEPVSDFILIDCPGSHTRLSQVAHSLADTLVTPLNDSFVDFDLLARIDPETGKVKGPSIYAEMVW 162 Rhodobacter sphaero...
2XJ9_A   165 EGRKQRALSg---QRQAMDWVVLRNRLATTEARNRKRLEDRLNALAKRVGFRIGPGLRDRVIYRELFPFGLTIA-DLSPQ 240 Caulobacter vibrioides
AVZ41658 156 EARKARGKR----DGKTVDWIVLRNRLQHLEARNMRHVASAMTELSKRVGFRIISGLSERVIYRELFLKGLTLL-DVKAL 230 Zymomonas mobilis s...
Q2G320   155 EARKKRAMAtikdARREMDWVVVRNRTGYTEARNQRRIDQALTELSKRVGFRIASGLSERVIYRELFPSGLTLL-DKGHL 233 Novosphingobium aro...
Q2N658   156 ESRIKRSKAtleeQRREMDWVVVRNRTGYTEARNMQRIERALAELSKRVGFRVTSGLSERVIYRELFPSGLTLL-DKGQL 234 Erythrobacter litor...
Q2W0K2   183 ETKKARAMRg---EKAVVDWIVLRNRLSTLDARNKRDMEKLLADLSKRVGFRVIPGLGERVIYRSMFLEGLTLI-DLKKK 258 Magnetospirillum ma...
CAL78289 174 DVRRKRRQV----DGAMTDWIVVRNRLSMLGSRNKQLVAEGLKDLSLRLGFRAIDGFAERVVYREFFPRGLTALdDIDEA 249 Bradyrhizobium sp. ...
Q28UF7   163 HARQLRAKA----GLQPTDWVVVRNRLPAQQMHNKAKMGRALEELSKRIGFRVAPGFSERVIFRELFPSGMTLL-DLRDM 237 Jannaschia sp. CCS1
Q3IZ08   163 SARQFRAQA----GLKPIDWIVLRNRLGAQQMHNKKKVGAALEDLSRRIGFRVAAGFSERVIFRELFPRGLTLL-DLRDT 237 Rhodobacter sphaero...
2XJ9_A   241 VrpvPVSLQHLAARQELRALMHSLGLS 267 Caulobacter vibrioides
AVZ41658 231 G---RAGLGHVAARQELRDLIAGLKLS 254 Zymomonas mobilis subsp. mobilis ZM4 = ATCC 31821
Q2G320   234 G---ELGTSHLVARQELRTLVSGLNLP 257 Novosphingobium aromaticivorans DSM 12444
Q2N658   235 G---DLGTSHLVARQELRQLVLGLNLP 258 Erythrobacter litoralis HTCC2594
Q2W0K2   259 PlgfDFNMSHVAARQELRTLVEAIGLG 285 Magnetospirillum magneticum AMB-1
CAL78289 250 TlgtRPNLGHVTAREEVTSLLRQLKLP 276 Bradyrhizobium sp. ORS 278
Q28UF7   238 Gv-eRMNISNVAARQELRDLIAALNLP 263 Jannaschia sp. CCS1
Q3IZ08   238 Gv-eQLSLSNIAARQEVRDLLIELKLP 263 Rhodobacter sphaeroides 2.4.1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap