Conserved Protein Domain Family
Glucodextran_N

?
pfam09137: Glucodextran_N 
Glucodextranase, domain N
Members of this family, which are uniquely found in bacterial and archaeal glucoamylases and glucodextranases, adopt a structure consisting of 17 antiparallel beta-strands. These beta-strands are divided into two beta-sheets, and one of the beta-sheets is wrapped by an extended polypeptide, which appears to stabilize the domain. Members of this family are mainly concerned with catalytic activity, hydrolysing alpha-1,6-glucosidic linkages of dextran to release beta-D-glucose from the non-reducing end via an inverting reaction mechanism.
Statistics
?
PSSM-Id: 401179
View PSSM: pfam09137
Aligned: 63 rows
Threshold Bit Score: 237.455
Threshold Setting Gi: 121692223
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Hbor_14970    686 APSGPESRPRWT-TGEKYGVGTVADhtedDPSRVWFTLT-EGSLTEVRFPRVDLMNLRTLDMLVvdadpessytartHNE 763  Halogeome...
AORICAS:Z0004785   33 APGAPGTGAAWT-TGGKEGFGTAAG----AASKVWFTLG-QGISHEIYYPTVDTANVQDLQYVVs------------DGA 94   Amycolato...
jgi:Caci_7155      46 ASGGPGTASFWNeTSGVQGFATALS----PSSKVWYTLG-NGGLENVFYPQTDNPDTYGLQYYVt------------DGS 108  Catenulis...
DU:RAM_23375       34 CCGG---GASWA-TGNKSALGTATT----TTSPVWFTVA-DGITSEVFYPRADIPNSQDRQFIVt------------DGS 92   Amycolato...
WP_013376751       19 APGHPGAPALWT-PANKAGFGTARS----AASRVWYTLGsRGDLTEVYYPTLSTPSVRELRFVVs------------DGR 81   Stigmatel...
CAM05479           33 APGAPGTDPGYA-GADKLGFGTSRD----AQSPVWFTLG-RGGAADLYYPNLSTPASRQLQVVVt------------DGA 94   Saccharop...
CHGC:AMES_8438     28 APGAPGTHPSWL-PANKTGFGTAHD----RSSNVWFTLQ-GGQLSEVYYPDMSTPSVRSMDFVVt------------DGR 89   Amycolato...
AORICAS:Z0007353   29 APGAPGAHPSWL-PADKTGFGTARE----QVSNVWFTLQ-GGRMSEVYYPDLSTPAVRALDLVVt------------DGT 90   Amycolato...
SIPI:L083_3633     81 APGAPGVDEQYL-PADKSGLGTTTT----TASRVWFTVQkEGGLGEVYYPTVGSPSTRALEFVVa------------DRR 143  Actinopla...
jgi:Bind_3431      26 APGAPGYKQGWS-PANKQGFGTSTT----HESNVWFTLG-GSGLTDVYFPRIDTPSIRDLQFVVs------------DGR 87   Beijerinc...
jgi:Hbor_14970    764 TRRDDAADTIERRAEMAEDDALLFRHVITEsgdgRGHEWTLTVEYATDPEHDALLADISFEATDDNEYDLFAVADTALVN 843  Halogeome...
AORICAS:Z0004785   95 GFTQLERDHTTKQLVLTDPRSLSYRQINTA----TNGRYRITKTHTADPARSTVLIQTRFEVLSGGPLQLYALYNPSLNN 170  Amycolato...
jgi:Caci_7155     109 SFTDGEATNTKHAIALADPASLTFTQTNTA----ASGKYAITKTYVADPARSVILVKTTFTNNGSTPLYLYADYLPQLNN 184  Catenulis...
DU:RAM_23375       93 TFVDLERDATNHVVTVPDEKALQYTITNTA----KSGKYRITTDYVTDPARATLVTNTRFQSLDGGSYRLYLLANPSMAG 168  Amycolato...
WP_013376751       82 TFAELESEATEHRVELADPRSLTFRQVNTA----RSGRYRLTKTYVTDPERHVVLIGVRFESLSGEPYSLHVVYDPSLSN 157  Stigmatel...
CAM05479           95 GFVQRLSDVPT-RTEPVDPKTPSYRQVSTG------QGWEATATYVTDPARPSVVVDLQVRSLDGKPLQTYVLHEPTLTK 167  Saccharop...
CHGC:AMES_8438     90 SFAVTDYSAKSQQVRRTGDDSLTYEQTVTD----DQHRWRLRKTYVTDPAATTVLVDVDFQSLTGRPYQLYAVADPDLTN 165  Amycolato...
AORICAS:Z0007353   91 SFATVDSSAKAQQVRRTG--GLTYEQTITD----DHRRWKLRKTYVTDPARASVLIDVDFVSLTGRPYQVYAVADPDLTN 164  Amycolato...
SIPI:L083_3633    144 GHAVRANAAATVRTTLIDERSLSYRQTFTE----RAHRWHLTTTYTSDPARSTVLINVSF---TGRGYDLFTVYDPALAN 216  Actinopla...
jgi:Bind_3431      88 TFAERESEATRYHVELAAPHSLVYRQINTA----NNKRYRLTKTYSTDPERAVLLVDVTFESLDGHPYQLYALLNPAPGN 163  Beijerinc...
jgi:Hbor_14970    844 TGGEDRGLRLgqmGSYHLVARDagpydqqgktrpllidrEgneySVAIAMTAAGRFDWGTVGVAG--SDHLSELFSEGEL 921  Halogeome...
AORICAS:Z0004785  171 SGMGDTGAT----SGGQLVASD-----------------G----PVSSALAASTGFVKATSGYSGtaSDGYVDLSGDHVL 225  Amycolato...
jgi:Caci_7155     185 QGMGNIGSTD---AGGDLVASN-----------------G----PMASALAASTPFSSASTGYVGtaSSGTAQLATGHTL 240  Catenulis...
DU:RAM_23375      169 GGANDNAWWD---STGALMASGtet------------lfGgtatTVVSALRVSTGFTAHDNGYSGaaSDCLVDLRADKTL 233  Amycolato...
WP_013376751      158 DGMDDVGTS----QEGALLASD-----------------G----TSASALLAAPALTRTSSGYLGv-SDGWSDLQDNFQQ 211  Stigmatel...
CAM05479          168 DGSDDRSRT----EGATLVASD-----------------R----SAASALRATPAFTETSSGYLGa-SDGWTDLSRHKRL 221  Saccharop...
CHGC:AMES_8438    166 DGSDDSAAR----SGDALTAQD-----------------A----TNAAALTAQPAFTTTSVGYAGa-SDGNTQLTKTFKL 219  Amycolato...
AORICAS:Z0007353  165 EGSDDSARA----DGASAVSSD-----------------A----KTAAALAAEPAFSRTSVGYSGs-SDGITQLTKSFSL 218  Amycolato...
SIPI:L083_3633    217 TRAGDSGRT----AGSTLVATD-----------------G----STASALVASPAFTATSNGFRGv-SDGWTDLLTDGRM 270  Actinopla...
jgi:Bind_3431     164 DQMHTHGET----FHHALVASN-----------------G----NVASAFTADPPFTRTSNGYLGv-SDGWQDLSSHHHM 217  Beijerinc...
jgi:Hbor_14970    922 PNAQESVD-NENVVLVGRIGS--GTNLGETIALGFAEHADTAAAlgEAAGALTRGYETVRTSYADSWAEFLA 990  Halogeometricum b...
AORICAS:Z0004785  226 GAQYDSAStPGNLVQLGQIPV--GTDTTFTLAVGFGSDRGAASA--NASASLAGGFASADTAYRSGWSGYLS 293  Amycolatopsis ker...
jgi:Caci_7155     241 GTVYSGVSsSGHIDQTAQIPVaaSGSTTFTLALGFDTTSAAAVS--DVSASLSSGFAAVQSSFQAGWHTWMS 310  Catenulispora aci...
DU:RAM_23375      234 TNQFDAVSgTGNVVQCGQIPV--GTDTTFTVAQGYGDTTAAATS--AASGSLSSGFTAVASSYRSGWNAYVN 301  Amycolatopsis med...
WP_013376751      212 DWAYASAA-PGNVVQTAQLEVdgRDRQQVTLALGFGTTPDEARV--AARDSLASGFEQVAERYAAGWHGYLD 280  Stigmatella auran...
CAM05479          222 TAHHPEAG-AGHVGQVGRLPVdgVGTSHAVLTLGYGKHASEAVA--TAEETERTGFEAAARAYGEGWHRYAD 290  Saccharopolyspora...
CHGC:AMES_8438    220 D-RYDTAA-KGNVVLTGRTNAdgVRDRHVTVALGMGAKAADALK--SAQASQRRGFRDIARAYDRGWQQYLR 287  Amycolatopsis med...
AORICAS:Z0007353  219 K-DYATAA-KGNVLITGQTSAdgVRSRDFTLSLGMGAKDTDALA--NAKASLRRGFADAARAYDRGWKQYLR 286  Amycolatopsis ker...
SIPI:L083_3633    271 DWHYQSTG-DGNLVQTAAIN------PHTTLALGFGTPATAAA---TARASLRRGFGAVARDYAYGWHRYLG 332  Actinoplanes sp. ...
jgi:Bind_3431     218 EWTYVVAD-QGNVVQTGQTTLdgVTRKHLTIAIGFGSTTTQAAS--QAQDALRTGFDRIAQAYAYGWRRYLA 286  Beijerinckia indi...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap