1I5P


Conserved Protein Domain Family
Endotoxin_mid

?
pfam09131: Endotoxin_mid 
Click on image for an interactive view with Cn3D
Bacillus thuringiensis delta-Endotoxin, middle domain
Members of this family adopt a structure consisting of three four-stranded beta-sheets, each with a Greek key fold, with internal pseudo threefold symmetry. Thus they act as a receptor binding beta-prism, binding to insect-specific receptors of gut epithelial cells.
Statistics
?
PSSM-Id: 117687
View PSSM: pfam09131
Aligned: 4 rows
Threshold Bit Score: 368.6
Threshold Setting Gi: 123291938
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1I5P_A         267 LMVSSGANLYASGSGPqqTQSFTAQNWPFLYSLFQVNSNYILSGISGTRLSITFPNIGGLPGSTTTHSLNSARVNYSGGV 346
Q2HYY4         267 LLVSSGANLYASGSGP--TQSFTAQNWPFLYSLFQVNSNYVLNGLSGARTTITFPNIGGLPGSTTTQTLHFARINYRGGV 344 Bacillus thur...
Q2HZG8         267 LLVSSGANLYASGSGPqqTQLFTSQDWPFLYSLFQVNSNYVLSGFSGASLFTTFPNIGGLPGSTTTQALLAARVNYSGGI 346 Bacillus thur...
LANL:BG08_6375 267 LMVSSGANLYASGSGPqqTQSFTAQNWPFLYSLFQVNSNYILSGISGTRLSITFPNIGGLPGSTTTHSLNSARVNYSGGV 346 Bacillus thur...
1I5P_A         347 SSGLIGATNLNHNFNCSTVLPPLSTPFVRSWLDSGTDREGVATSTNWQTESFQTTLsLRCGAFSARGNSNYFPDYFIRNI 426
Q2HYY4         345 SSSRIGQANLNQNFNISTLFNPLQTPFIRSWLDSGTDREGVATSTNWQSGAFETTL-LRFSIFSARGNSNFFPDYFIRNI 423 Bacillus thur...
Q2HZG8         347 TSGSIGGPNFNQNFNCNTISPPLSTSFVRSWLDSGSDRQGVNTVTNWQTESFETTSgLRCGAFTPRGNSNYYPGYFIRNI 426 Bacillus thur...
LANL:BG08_6375 347 SSGLIGATNLNHNFNCSTVLPPLSTPFVRSWLDSGTDREGVATSTNWQTESFQTTLsLRCGAFSARGNSNYFPDYFIRNI 426 Bacillus thur...
1I5P_A         427 SGVPLVIRNEDLTRPLHYNQIRNIespsGTpgGARAYLVSVHNRKN 472
Q2HYY4         424 SGVVGTISNADLARPLYFNEIRDI----GT--TAVASLVTVHNRKN 463 Bacillus thuringiensis
Q2HZG8         427 SGVSLVLRNEDLKRPLYYNEKRNIespsGTpgGARAYMVSVHNKKN 472 Bacillus thuringiensis
LANL:BG08_6375 427 SGVPLVIRNEDLTRPLHYNQIRNIespsGTpgGARAYLVSVHNRKN 472 Bacillus thuringiensis serovar kurstaki
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap