1MG7


Conserved Protein Domain Family
Xol-1_N

?
pfam09108: Xol-1_N 
Click on image for an interactive view with Cn3D
Switch protein XOL-1, N-terminal
Members of this family, which are required for the formation of the active site of the sex-determining protein Xol-1, adopt a secondary structure consisting of five alpha helices and six antiparallel beta sheets, in a beta-alpha-beta-beta-beta-alpha-beta-alpha-alpha-alpha-beta arrangement. The fold of this family is similar to that found in ribosomal protein S5 domain 2-like.
Statistics
?
PSSM-Id: 401156
View PSSM: pfam09108
Aligned: 2 rows
Threshold Bit Score: 277.285
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1MG7_B        18 RSENSPVLTYMETEddpnFRNSKLAAAPHTVHMMDSGFLAINRQCLVKGKAILAREPKSSNEHMIDDLPKHAHDQHTLSI 97  Caenorhabditis ...
1_pfamImport   1 RTSRYPVLETMELA----ATNEIYASAPHTVHIMGTAYIAVNRYCIVKGQKTSTQPARDVMEHLIDDLPDHKDFDRTLDI 76 
1MG7_B        98 LRDFIDQLKLHNVYEINFYDPLDSSGKLAVIPMLIALWKCMLASETDICDqEVLKSIMNSVIAKFELQIPCKNAVIDATL 177 Caenorhabditis ...
1_pfamImport  77 LSEFMKGLNLQNVFSFKILSPFDYSEQFSIIPVMLAMSKFFECFESTMSD-DLVRDAMNNAMDKFELEISGRKEIIEATI 155
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap