1JJU


Conserved Protein Domain Family
Qn_am_d_aIV

?
pfam09100: Qn_am_d_aIV 
Quinohemoprotein amine dehydrogenase, alpha subunit domain IV
Members of this family, which are predominantly found in the prokaryotic protein quinohemoprotein amine dehydrogenase, adopt an immunoglobulin-like beta-sandwich fold, with seven strands arranged into two beta sheets; the fold is possibly related to the immunoglobulin and/or fibronectin type III superfamilies. The precise function of this domain has not, as yet, been defined.
Statistics
?
PSSM-Id: 401150
View PSSM: pfam09100
Aligned: 15 rows
Threshold Bit Score: 178.716
Threshold Setting Gi: 237624891
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1JJU_A                 356 ISIVPDLTIARIGGNGGPI-PKVPAQFEAMGWLNGPDGQPGTGDDIALGAFPASWATDNFDEEAEKMQDAKYAGSI-DDT 433
zhongguo:SL003B_2489   391 LRVEPAYAVARVGGGGGSA-GKVPARFEAIGYWNGPDGEPGTDDDVRIGAVPASWSVEPFNEEAETLKDVEHAGAMdETS 469 Polym...
WP_011747998           379 ISIVPDLTIARIGGNGGPI-PKVPAQFEAMGWLNGPDGQPGTGDDIALGAFPASWATDNFDEEAEKMQDAKYAGSI-DDT 456 Parac...
WP_011764972           394 VKVVPAFAVARIGGNGTPS-PKVEGRFEAEAWAAGRDGKPGTADDYRIGIVPAKWSVAPHDEVAARDEDVRFAGVMqPDT 472 Azoar...
WP_012584626           393 VKVSPAFAVARIGGNGTPT-AKVEARFDAEAWAAGADGKAGTEDDFRIGVVPAKWSVEPFDEAAVRDQDVEFAGLMdAAS 471 Thaue...
WP_015436627           402 VRVEPAFGIARLGGGTN---PPVSAQFDAVAFLNGPDGKPGTEDDIRLGSVPATWSAEPFDERAKHDEDLKYAGHL-EPH 477 Azoar...
Q5P0U9                 417 VRVEPAFAVARLGGGTV---APMSAQFDAIAFLNGADGKPGTDDDIRLGSVPATWSTEPFDERARHDEDARYAGHM-ASH 492 Aroma...
ACR01581               396 VEVEPANAIARVGGPGDAQmQKVGVAYRAIGWAAGRDGKAGTADDLRLGYLPARWSIEAADEEAEKAHDADFVGHI-GAD 474 Thaue...
PRJNA213647:NX02_15530 434 LKVVPETGLARLGGVKH---PKGYGQFEALGYGNGADGKPGTPDDVKIGPVDVTWSIDEF-MAVYNDDDKDFVGAL-SAN 508 Sphin...
Q2G3W0                 455 LKVAPDSAIARLGGSEKH--TPGYQQFEAIGYDNGLDGKPYTADDVAIGPVDASWSMEEF-QTVYYDDDTSYVGKL-SDK 530 Novos...
1JJU_A                 434 GLFTPAEAGPNPERPMQTNNAGNLKVIATVDAEge----plSAEAHLYATVQ---RFVDAPI 488
zhongguo:SL003B_2489   470 GIFMPAVAGPNPDRPFSTNNAGNLKVLARSGEA--------AGEAQLIVTVQ---RWNDPPI 520 Polymorphum gilvum SL00...
WP_011747998           457 GLFTPAEAGPNPERPMQTNNAGNLKVIATVDAEge----plSAEAHLYATVQ---RFVDAPI 511 Paracoccus denitrificans
WP_011764972           473 GIFVPGGAGPNPARRMSANNVGNLKVVAEVVQGge----rvQGEGHMIVAAQ---RWNNPPL 527 Azoarcus sp. BH72
WP_012584626           472 GVFVPGDAGPNPVRRMSASNVGNLKVVAEVAQGge----rlRGEGQVIVAPP---RWNNPPL 526 Thauera sp. MZ1T
WP_015436627           478 GQFLPAFAGPNPNRR-GLNNVGNLSVVASVADGdr----qlNAKGQLVVTVQ---RWN--PT 529 Azoarcus sp. KH32C
Q5P0U9                 493 GQFVPSFAGPNPLRRGGINNVGNLSVIATVADGdq----tlNGKGQLMVVAQ---RWNPTPL 547 Aromatoleum aromaticum ...
ACR01581               475 GVFVPGDAGPNPARPKSLGNTGRVNVVATVEAAga----tvEGRGKLDVAVP---DFVQRal 529 Thauera sp. MZ1T
PRJNA213647:NX02_15530 509 ALFTPASEGPNPNRRFGRNNYGEVWVVATAKTEkdkfgqplTGRAYLVVTVPayqRWDQPEV 570 Sphingomonas sanxanigen...
Q2G3W0                 531 ALFTPAMDGPNPARKWGRNNYGEVWVVATAKTEkdalgkplTAKSFMVVSVPaykRWDQPEV 592 Novosphingobium aromati...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap