1JJU


Conserved Protein Domain Family
Dehyd-heme_bind

?
pfam09098: Dehyd-heme_bind 
Quinohemoprotein amine dehydrogenase A, alpha subunit, haem binding
Members of this family are predominantly found in the prokaryotic protein quinohemoprotein amine dehydrogenase. They have a predominantly alpha-helical structure and can be divided into two subdomains, each binding a haem C group via a conserved CXXCH motif.
Statistics
?
PSSM-Id: 401149
View PSSM: pfam09098
Aligned: 5 rows
Threshold Bit Score: 296.793
Threshold Setting Gi: 500088959
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1JJU_A          2 TGEEVLQNACAACHVQHEdgRWERIDAARKTPEGWDMTVTRMMRNHGVALEPEERAAIVRHLSDTRGLSLAETEERRYIL 81 
Q5P0U9         49 AAQQLLEAKCGACHLDNG--KLNRISEIRKSPEGWDMTVVRMGIWHKVELTPGERQTIVKYLADRQGLAPSESAPYRPLT 126 Aromatoleum ar...
WP_011764972   29 AGDALIAEKCLVCHADAQg-gSGRIAQQRKTPEGWLMTVARMQLTHGLQVTDAERREIVKYLADTQGLAPSESAGARYAI 107 Azoarcus sp. BH72
USDA:Abu_0465  29 KGKEVIESKCIACHTGDLkdGLSRISDQRKTPEGWYMTVKRMQREHGLSITKAEETDVIKYLADYQGLTPDEIKPYSYVL 108 Arcobacter but...
WP_011747998   25 TGEEVLQNACAACHVQHEdgRWERIDAARKTPEGWDMTVTRMMRNHGVALEPEERAAIVRHLSDTRGLSLAETEERRYIL 104 Paracoccus den...
1JJU_A         82 EREPVAWDEGPDTSMTQTCGRCHSYARVALQRRTPEDWKHLVNFHLGQFPTLEYQALARDRDWWGIAQAEIIPFLARTYP 161
Q5P0U9        127 ERQPNMQDTAPDEELAQMCGRCHSYGRVALQRRDEGEWRKLMHTHLGQFPSAEYSAMGRDRNWWEIARDQLPPRLAALYP 206 Aromatoleum ar...
WP_011764972  108 ERRLNTVEQFESAEFTQMCARCHSGARVLLQRRTASEWEHLIHFHLGQFPTAEYQALGRDRDWFGVALKDIAPMLARTQP 187 Azoarcus sp. BH72
USDA:Abu_0465 109 DKKPNVQEEGKDELLTQMCVRCHSEARIGLQRRTANEWNSLVNYHVAQFPSFEVQAQARDRDWFGVAQNEVVPYLEENFG 188 Arcobacter but...
WP_011747998  105 EREPVAWDEGPDTSMTQTCGRCHSYARVALQRRTPEDWKHLVNFHLGQFPTLEYQALARDRDWWGIAQAEIIPFLARTYP 184 Paracoccus den...
1JJU_A        162 LGEA 165
Q5P0U9        207 KDTP 210 Aromatoleum aromaticum EbN1
WP_011764972  188 FESA 191 Azoarcus sp. BH72
USDA:Abu_0465 189 KDKE 192 Arcobacter butzleri RM4018
WP_011747998  185 LGEA 188 Paracoccus denitrificans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap