Conserved Protein Domain Family
Lyase_catalyt

?
pfam09093: Lyase_catalyt 
Lyase, catalytic
Members of this family are predominantly found in chondroitin ABC lyase I, and adopt a helical structure, with fifteen alpha-helices which are at least two turns long and several short helical turns. The bulk of the domain is formed by ten alpha-helices forming five hairpin-like pairs and arranged into an incomplete toroid, the (alpha/alpha)5 fold. Additionally, two long and two short alpha-helices at the N-terminus of the domain wrap around the toroid. At the C-terminal end of the toroid there is one additional short alpha-helix. This domain is required for degradation of polysaccharides containing 1,4-beta-D-hexosaminyl and 1,3-beta-D-glucoronosyl or 1,3-alpha-L-iduronosyl linkages to disaccharides containing 4-deoxy-beta-D-gluc-4-enuronosyl groups.
Statistics
?
PSSM-Id: 401147
View PSSM: pfam09093
Aligned: 14 rows
Threshold Bit Score: 419.064
Threshold Setting Gi: 524056384
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q0WIL0         254 PAKLPaPTAGEIAAADDIRGALIRVFTEgQgGENglvVVDN-----REKLRAHFAALKIQRDAdG-QLSGRHIITDKQKV 327  Yersinia pestis
jgi:Phep_0784  218 lTLAEgVTRQELLDLELISSRYIDMIMPvK-GTL---VKNM-----LEEIEKGFAYWNIRRE--GsRISGRPVYSMNDTE 286  Pedobacter h...
WP_012368258   243 VQPQLpVTPENLAAIDLIRQRLINEFVGgE-KETnlaLEEN-----ISKLKTDFEALNIRPLSdG-GMQGRHLITDKQTI 315  Proteus
WP_015872512   243 ATPTLaMTPASQAGVELIRQRLIDEFVNgP-QDStlkAEAD-----LGKLRAAFDALQIRQAAdG-TLSGRHLITDKQKI 315  Edwardsiella...
CCY38468       196 LNYSYpASSEQKEALSTIKERIDNWFLNtNhTSTifnKRKNsinnwIKRAQNNFTSINLIVQNdG-SVLGPGLFPQYAST 274  Tannerella s...
Q8A2F5         203 VPLLSkLTTRQKKDLKTIEQRLTEFLd--V-KKA---PQGQ-----INAARKTFERAAIAPSAaGtGFTGTPVVAPDEQD 271  Bacteroides ...
OKZ06238       213 lpLKP-VSEKELQDMHLMEKRYRDLIYT-P-GKL---SQKQ-----IDKIRRNYDAYKIVYKN-G-KVSGLPIFMVRQSE 279  Bacteroides ...
Q8A2I1         204 IELTP-VSDRQRQEMKLLEKRFRDMIYT-K-GKV---TEKE-----AETIRKKYDLYQITYKD-G-QVSGVPIFMVRASE 270  Bacteroides ...
CCY39300       214 ITLEAtVTPQQKKEIALLESRLREIIYQ-P-SQL---IDKT-----MQSIRKAYARYGITYNNrG-EVKGMPLFFGRAVE 282  Tannerella s...
WP_130058071   215 IPLEAtVSNTQKQEIEIIEKRLREIICP-P-GEV---TSQT-----IANLRKAYEHYGIVYKD-G-KVAGLPLFYGRAAE 282  Bacteroides ...
Q0WIL0         328 LYQPEFMDDIDQQRFSDYVLLGDY-TTLMFNISR-AYQRSTSEE-VRQELADMYILMTQHLLDQGYMDGSGLVTTHHWGY 404  Yersinia pestis
jgi:Phep_0784  287 LVSLSPAENVKE--ANRLSGIKRY-TQLMLQVAQ-AFHAGTDAK-EKLRLENIFMDMLDHLEDQGWAYGSGMGALHHHGY 361  Pedobacter h...
WP_012368258   316 IYQPEQLNSQDKQLFDNYVILGNY-TTLMFNISR-AYVLEKDPT-QKEQLKQMYLLMTKHLLDQGFVKGSALVTTHHWGY 392  Proteus
WP_015872512   316 LYQPEHLSAQDKAKFDRYVILGDY-TTLMFNISH-AYRQNSDPA-VQRQLADMYLLMTRHLLDQGFARGSGLVTTHHWGY 392  Edwardsiella...
CCY38468       275 SID-----------NENILRFRDTnEKYLIQFALdYRLNHN------ETSKENYLKILDWYADQGWSCGSALGALRFEKL 337  Tannerella s...
Q8A2F5         272 K-------------KKGEMSWNDI-ETMLAGFAYdAFYNQN------ETSKKNYFTVFDYAMDQGFAFGSGMGTNHHYGY 331  Bacteroides ...
OKZ06238       280 AYERMIPHWNKDMFTKLGMEMKAY-FDLMKTIAV-AYHNAQDAQ-VKQEMRQKFMAMYDHITDQGVAYGSCWGNIHHYGY 356  Bacteroides ...
Q8A2I1         271 AYERMIPDWDKDMLTKMGIEMRAY-FDLMKRIAV-AYNNSEAGSpVREEMKRKFLAMYDHITDQGVAYGSCWGNIHHYGY 348  Bacteroides ...
CCY39300       283 AYERIVPNYNPNIFNDNHMELKEY-FNLMNKIAI-AYNNATEEK-DKLELEKMFLAMYDHVTDQGVAYGSCLGNFTHYGY 359  Tannerella s...
WP_130058071   283 AYERILPNWKGNLMAANNMDVSSF-FNLMNRIAV-AYNNTTNPQ-DKAVLKQMFIAMYDHITDQGVAYGSCLGNITHYGY 359  Bacteroides ...
Q0WIL0         405 SSRWWYISAMLMANELDKHQLRQPVSDALLWYSRefKANFDMVPGPESSD--LDYFNTLSRQHLALLMLESDPAKRVALL 482  Yersinia pestis
jgi:Phep_0784  362 NLEGYYPSCLLMKDVIKRQGKLERTFQSMSWFSG--LGRTLQRPLPSSN---IDVFNTLLGSMLSSILIMDNSPEKLRYL 436  Pedobacter h...
WP_012368258   393 SSRWWYISTLLMADALKEANLQTEVYDSLLWYSRefKSSFDMKVGANSSD--LDYFNTLSRQHLALLLLEPDDQKRINLV 470  Proteus
WP_015872512   393 SARWWYISALLMNPVLDQARLTQPVYDALLWYSRefKASFDMKVGPESSN--LDYFNTLSRQHLALLLLEPDPQQRIDLL 470  Edwardsiella...
CCY38468       338 RSAGYFHSLYLMKDELGDS-RFSRELETLKWFSL--LGDIYINTDNDASGetADNLRTLAIAKLYCALMLSDENAQTETL 414  Tannerella s...
Q8A2F5         332 QVRKIYTTAWLMRDAIYKHPHRDAYLSTLRFWAA--LQET-RQPCPPERDelLDSWHTLLMAKFISAMMFPDAREQEQAL 408  Bacteroides ...
OKZ06238       357 SVRSLYLSYFLMKDVLREENRLAEAEATMRWYAI--TNEVYPKPTGNGID--MDSFNTQTSGRIASILMMEDTPEKLRYL 432  Bacteroides ...
Q8A2I1         349 SVRGLYPAYFLMKDVLREEGKLLEAERTLRWYAI--TNEVYPKPEGNGID--MDSFNTQTTGRIASILMMEDTPEKLQYL 424  Bacteroides ...
CCY39300       360 SFRGYYTSYFLMKDVLRKAGKLDDAEKGMRWYSI--ANEVFIKPDVWGLD--MDSFNTTTTGRIASILMMEDSPEKVQYL 435  Tannerella s...
WP_130058071   360 SFRTFFTAYFLMKEVFKEIGKQEEAEKAMLWYST--VNDVYNKPQTAGID--IDFFNTLSTGRIASILFMEDTPEKVQYL 435  Bacteroides ...
Q0WIL0         483 KRFGEYINVALSQTpPGGYDGLRPDGTAWRHEGNY-PGYSFPAFKNAGQLVYMLHGTPFAVSDEGRAALKKAMLSAWVYS 561  Yersinia pestis
jgi:Phep_0784  437 HSFSNWLSENVKPD-HTIEGAFKPDGAVFHHGNLY-PAYGIGGYTGISPVVFALSGTSFRMDQEAHESLRNSLLMMHYYT 514  Pedobacter h...
WP_012368258   471 NSFSHYITGALTQVpPGSKDGLRPDGTAWRHEGNY-PGYSFPAFKNASQLIYLLRETPFAVGESGWNNLKKAMISAWIYS 549  Proteus
WP_015872512   471 NSFSHYISDALAQTpPGSNDGLRPDGTAWRHEGNY-PGYSFPAFKNAAQLAYLLRGTPFALQQDGLDKLKQAMVAAWIYS 549  Edwardsiella...
CCY38468       415 LTLKEYFTNALSPA-GGFRGTFKPDFTGYHHRGVYlGAYYPDALYIGCFLFYLLHDTPFELSESIYIQLKNSLLMLRNIA 493  Tannerella s...
Q8A2F5         409 NGLSRWLSSSLNYT-PGTLGGIKVDGTTFHHGGFY-PGYTTGVLATIGQFIALTNGTGFELTEEARQHIKSAFLAMRNYC 486  Bacteroides ...
OKZ06238       433 RAFSRWIDYGCRPA-PGLAGAFKSDGAAFHHRNNY-PAYAVGGLDGATNMIYLMSGTTFAVSELAHQTVKDVLLTMRFYC 510  Bacteroides ...
Q8A2I1         425 KSFSRWIDYGCRPA-PGLAGSFKVDGGAFHHRNNY-PAYAVGGLDGATNMIYLFSRTSLAVSELAHRTVKDVLLAMRFYC 502  Bacteroides ...
CCY39300       436 KAFSRWINNGCLPA-DGLLGSFKPDGGAFHHCNNY-PAYAVGGLDGATNMIYLLSRTSFAVSELGHNTVKNVLLAMRFYC 513  Tannerella s...
WP_130058071   436 KSFSRWIDNGCLPA-EGLNDAFKADGSAYHHCNNY-PAYATGGLTGATNMIYLLSHTGFAVSELAHQTVKEVLLTMRFYC 513  Bacteroides ...
Q0WIL0         562 NP-ATSLGLAGRHPFNSSSVTLFqdAFRWLALTGDPKTG-DKVDKALAAAYLQITETPESE 620  Yersinia pestis
jgi:Phep_0784  515 HPfKWPVSVAGRHPTGSWRIADL--PYAYMAMAGTPDGK-NKTDSLMAAIYLKLNEGKKNR 572  Pedobacter heparinus DSM 2366
WP_012368258   550 NP-EVGLPLAGRHPFNSPSLQSIaqGYYWLAMSAQPAP-----DKQLASIYLAISGKSRNE 604  Proteus
WP_015872512   550 NP-QTGISLAGRHPFNSPSLESLtnAYYWLAISYDKRP-----DATLAAIYLRLANKTAAD 604  Edwardsiella ictaluri
CCY38468       494 ALyDVPATTCGRFPNSNTVLDDLvaAFAYLIESK------NGTDNELNAAFGRLWKPEESP 548  Tannerella sp. CAG:118
Q8A2F5         487 NLyEWGTGISGRHPFGGKMGSDDieAFANIALSGDLSGQgNTFDHGLAADYLRLIRDRNTR 547  Bacteroides thetaiotaomicron
OKZ06238       511 NQqQFPLSMSGRHPNGKGKLIPV--QYAMMAISGTPDGK-EKYDADMAAAYLRLVREPAKp 568  Bacteroides plebeius
Q8A2I1         503 NKlNFPLSMSGRHPDGQGKLVPM--HYAMMAIAGTPDGK-GDFDKEMASAYLRLVSSDSSS 560  Bacteroides thetaiotaomicron VP...
CCY39300       514 NKlDFPWSMSGRHPDGKGKLVPM--HYAMMALAGTPDKS-QTIDKEMGNAYLRLVTNVken 571  Tannerella sp. CAG:118
WP_130058071   514 NKrSFPLSMSGRHPNGKGELIPS--HYAIMALAGSPDRH-QEIDTAMAGAYLRLTEKPYKR 571  Bacteroides salyersiae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap