4HD9


Conserved Protein Domain Family
Adhes-Ig_like

?
pfam09085: Adhes-Ig_like 
Click on image for an interactive view with Cn3D
Adhesion molecule, immunoglobulin-like
Members of this family are found in a set of mucosal cellular adhesion proteins and adopt an immunoglobulin-like beta-sandwich structure, with seven strands arranged in two beta-sheets in a Greek-key topology. They are essential for recruitment of lymphocytes to specific tissues.
Statistics
?
PSSM-Id: 401142
View PSSM: pfam09085
Aligned: 10 rows
Threshold Bit Score: 143.785
Threshold Setting Gi: 558183830
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4HD9_A        91 AFPNQLTVSPAALVPG-DPEVACTAHKVTPVDpNALSFSLLVGGQELEGAQALGPevqEEEEEPQGDEDV-LFRVTERWR 168 human
ELV09309     565 AFPDQLTVSPVVLVPEqEQEVTCTAHNVTPTSqDTLSFSLLLGDLELEGAQALAP---EVREEPQEGDDT-LFHVTQRWL 640 Chinese tree shrew
NP_038619    110 AFPDQLVVSPEFLVPGqDQVVSCTAHNIWPADpNSLSFALLLGEQRLEGAQALEP---EQEEEIQEAEGTpLFRMTQRWR 186 house mouse
XP_003502644 110 AFPDQLVVSPKFLVPGeDQEVSCTAHNIFPPGpDILSFALLLGEQSLEGAQALEP---EQEEETQGAEVTtLFRMTQRWL 186 Chinese hamster
XP_012659868 117 AFPDQLTVSPATLVPGvDQEVACTAHKVTPVGsDALSFSLILGDRELEGVQALGSp--EIEEEPQEDEDL-LFHVTQRWL 193 small-eared galago
XP_007489492 130 AFPDKLEVSPSTLVLGqAATLVCSAREVSPYD-SRLTFAWYQGDEKLGELELLYEd-lKPEQEAETGEDLeVFQVTKHWA 207 gray short-tail...
XP_005332229 111 AFPDQLAVSPATLVPGrNQEVACTAHSVSPTD--TLSFSLLLGNRELEGVQALGRe--EKEEDLQETEDL-LFRVTQRWL 185 thirteen-lined ...
NP_001033109 112 aFPDQLSVSPEAVVPGrDQEVACTAHNVTPAGpDTLSMSLLLGGRELEGVEAFP----DMTEEPQEGEDP-LFQVTQRWL 186 sheep
XP_006101886 112 AFPNQLTVSPVDLVAGrDQELACTAHNITPASpDVLSLSLLLGDQELEGVQELGL---EEDEEPQEGEDP-LFQVTKRWL 187 little brown bat
XP_003981673 112 AFPAQLTVSPVALVAKqDREVACTAHNVTPVSpEALSLSLLLGDRELEGVQALGR---DVEEEPQQGEDL-LFRVTERWL 187 domestic cat
4HD9_A       169 LPPLGTPVPPALYCQATMRLPGLELSHRQAI 199 human
ELV09309     641 LPPLGTHLPPALHCQVTMRLPGLLLSHRRAI 671 Chinese tree shrew
NP_038619    187 LPSLGTPAPPALHCQVTMQLPKLVLTHRKEI 217 house mouse
XP_003502644 187 LPSLETPAPPVLYCQATMKILDLVLTRKREL 217 Chinese hamster
XP_012659868 194 LPPLGTPILPNLYCQATMRLPGLELSRHQAI 224 small-eared galago
XP_007489492 208 LPAELVTLGPELRCQVEMKLEHQVLSHSRGI 238 gray short-tailed opossum
XP_005332229 186 LPPLGTPAPPTLHCQATMRLPGLELSHRRAL 216 thirteen-lined ground squirrel
NP_001033109 187 LPASETSSLHTLHCQVTMRLPGLELTRHRSI 217 sheep
XP_006101886 188 LPPLGTP-PLTLHCQATMRLPGLELSHRKPI 217 little brown bat
XP_003981673 188 LPPLGTPTPPTLHCQATMKLPGLELSHHQPI 218 domestic cat
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap