1GH9


Conserved Protein Domain Family
DUF1922

?
pfam09082: DUF1922 
Click on image for an interactive view with Cn3D
Domain of unknown function (DUF1922)
Members of this family consist of a beta-sheet region followed by an alpha-helix and an unstructured C-terminus. The beta-sheet region contains a CXCX...XCXC sequence with Cys residues located in two proximal loops and pointing towards each other. This precise function of this set of bacterial proteins is, as yet, unknown.
Statistics
?
PSSM-Id: 401140
View PSSM: pfam09082
Aligned: 8 rows
Threshold Bit Score: 85.9617
Threshold Setting Gi: 121724251
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1GH9_A            2 YIIFRCD-CGRALYSREGAKTRKCVCGRTVNVKDRRIFGRADDFEEASELVRKLQEEKYGSCHFTN 66  Methanothermobacter therma...
CDG65794          2 YLVFRCD-CGRAVYAREGVRQKKCVCGKNLNVKERRILAKTQDAQDAAEKVQELQEEKYGGAYFTT 66  Methanobacterium sp. MB1
Q2NI59            3 YLIYRCD-CGRVLYSKETTKTKKCTCGKTLNVKKRRILKIAQSSTQATETVQQMQEEIYGGSIFRT 67  Methanosphaera stadtmanae ...
WP_012956749      2 YVIFRCD-CGRVLYAKQGVKTRKCTCGKTIKVKSRRILQKVETANDASLAVQKMQEEIYGGTAFKT 66  Methanobrevibacter ruminan...
NZAGRC:Abm4_1537  2 YLIFRCD-CGRVLYAKKGQATRKCVCGKVLKVKERRIFKKVATREEASKAVQDMQEEIHGFKGFQT 66  Methanobrevibacter sp. AbM4
bsuwp:MCON_1888   1 --MFRCS-CGRHLYSPDDAKTRTCPCGKRTALSRVRILATAPDARAAGEIVRRLQLGDSGLTGFSQ 63  Methanothrix soehngenii GP6
WP_014585695      2 YLIFRCSgCGRHLYAEEGSATRTCPCGKRIKLGQVKVLSRARDEREAGDLVRALQVEGRGMTGFSP 67  Methanosaeta harundinacea
jgi:Mfer_1240     2 YLIFRCD-CGRALYVHESNSVKRCVCGRLIKVKSRRILGKVNSFEEASEIVRKLQEEKYGKAVLMT 66  Methanothermus fervidus DS...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap