Conserved Protein Domain Family
Smac_DIABLO

?
pfam09057: Smac_DIABLO 
Second Mitochondria-derived Activator of Caspases
Second Mitochondria-derived Activator of Caspases promotes apoptosis by activating caspases in the cytochrome c/Apaf-1/caspase-9 pathway, and by opposing the inhibitory activity of inhibitor of apoptosis proteins (XIAP-BIR3). The protein assumes an elongated three-helix bundle structure, and forms a dimer in solution.
Statistics
?
PSSM-Id: 401119
View PSSM: pfam09057
Aligned: 12 rows
Threshold Bit Score: 289.053
Threshold Setting Gi: 340007408
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_027325975   8 LRSCRSLLRR-------------GFP----VLAAARRQpglSGGSRRWQQAlgVGLGAALCAVPVIEKQNSsSLSNDALI 70  mallard
NP_001232563   8 LRSCCSVLRR-------------SFP----VLAGVRQRg-lAGRSGQWHQA--VGLGVALCAVPVVEQQSSgSLSNDALI 67  zebra finch
Q5RBH2         9 SRSVTLLFRYrq---------clCVP----VVANFKKRc-fSELIRPWHKTvtVGFGVTLCAVPIAQKSEPhSLSSEALM 74  Sumatran orangutan
XP_008248773  42 SRSASAWLRRg-----------rCVP----AAAGGPKRc-fSELVRPWRRAaaVGLGVTLCAVPIAQESEPhSLSNDALM 105 rabbit
Q0IJ31         9 IWSFSYILRE-------------SFP----IVSRRNCV---SLLRASWRKVlsVGVGTSVCAIPVGQRSEP-TLSSESLI 67  tropical clawed...
XP_005989033  19 RRRAP-LVAErsshrllgavssvSVP----RGT--------------WSRLv-LGFGATLCAVPISQKTESvSLSHGALI 78  coelacanth
NP_001229963  13 LSYAASLLSSggscqa--grrlfLLP----GIF--------------RKHWrtLSVTGAICAVPFLQKPE--NLSHEDLV 70  zebrafish
NP_956640     43 KHKTSVLCNSsvhq-----rilqRLP----NVA--------------RSNAvpFSVGTGLCAVPFTQQVE--NLSHESLI 97  zebrafish
XP_003968615  15 RRAACVLLNYrnh--------aiQNPgkwaNIL--------------YTSLasFTIGAGFCAVPFKQADQ---LSHDSLI 69  torafugu
XP_015197532  15 RCSWSVLSSSrhr--------ivRIP----LLL--------------RSNFlsLGAGGGLCAVPFSKQAE--NLSHEALI 66  spotted gar
XP_008118066   8 wlrtwCFLARq------------SRP----LLAPLRTRc-aSGLRGPWSKAaaLGLGATLAAIPITQKHDPsSLSNEALI 70  green anole
XP_003761096   9 LRSVGSFFr-------------qSVP----VVTRLRRCr-lTDLVGPWHKTvaVGFGVSLCAVPIAQKTEThSLSNEALM 70  Tasmanian devil
XP_027325975  71 KRAVSLVTDSTSTLLSQTTYALIEALTEYTKAVYTLVSLYKQYSNLLGKMNSEEVDAVWQVVIGARVDMTTKQQEYLRLE 150 mallard
NP_001232563  68 RRAVSLVTDSTATLLSQTTYALIEALTEYTKAVYTLVSLYKQYSNLLGKMNSEEVDAVWQVVIGARVDMTTKQQEYLRLE 147 zebra finch
Q5RBH2        75 RRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSQEEDEVWQVIIGARAEMTSKHQEYLKLE 154 Sumatran orangutan
XP_008248773 106 KRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLISLYRRYASLLGKMNSQEEDEVWQVIIGARVEMTSKQQEYLKLE 185 rabbit
Q0IJ31        68 KRAVSLVADSSSTFLSQTTYALVESLTEYTTAVYTLISLQQKYTSLLDKMNSNEESAIWQVIIGARVQMKQLKEQYLKYE 147 tropical clawed...
XP_005989033  79 KRAVSLVTDSANTYLSQTTLALIDALTEYTKAVHILVSLQQQYANLVGKINPKEEEAIWQVIIGARVEMNEKQQEYLTFE 158 coelacanth
NP_001229963  71 RRASSLVTDSANTFLSQTTLALIDSFTGYIKAVNILVELHKQYEASISKFTPEEENAIWKVILGQRQEVIGRRKNCTHFE 150 zebrafish
NP_956640     98 RRASCLVTDSANTYLSQTTLALVDALTQYAKALHTLISLQKRYIASIGKLSPVEEDSIWQVIIGQRVEVSDRLEECKRFE 177 zebrafish
XP_003968615  70 KRAASLVTDSSTTLLSQTTLALIDAITDYSKAVHTLIALQKRYLDSLGKLSPAEEDRIWQVIIGQRAEVNDRRDQWLRFE 149 torafugu
XP_015197532  67 RRASSLVTDSANTYLSQTTLALVDALAQYAKAVHTLIALQKRYMNSIGKLTPAEEDAIWQVIIGARVEMNDKLDTCRHFE 146 spotted gar
XP_008118066  71 RRAASLVTDSTGTLLSQTTYALIDALTEYTTAVYTLVSLYQKYAHLIGKMNSKEEDAVWQVIIGARVEMTEKQQEYLKLE 150 green anole
XP_003761096  71 RRAVSMVTDSTSTFLSQTTYALIEAITEYTRAVYTLVSLYRKYSSLLGKMNSQEEDAVWQVIIGARVEMSSKQEEYLKLE 150 Tasmanian devil
XP_027325975 151 SSWMTALRLSEMAAEAAYQSGADQASVTARSHIQLVKSQVQEVRQLSQKAETKLAEAQTEEL---IKAQGEESSLPQG-- 225 mallard
NP_001232563 148 SSWMTALRLSEMAAEAAYQSGADQASVTARSHIQVVKSQVQEVRLLSQKAETKLAEVQTDEL---IKATGEDSSLPQGvl 224 zebra finch
Q5RBH2       155 TTWMTAVGLSEMAAEAAYQTGADQAPITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELrqkTQEEGEERAESEQ-- 232 Sumatran orangutan
XP_008248773 186 TTWMTALSLSEMAAEAAYHTGADQASVTARSHVQLVKSQVQEVRQLSQKAEIKLAEAQTQELrqkTQERGEGRPEPEPe- 264 rabbit
Q0IJ31       148 SSWQRAVSLSEMAAEAAYQSGADQASVTVRNHIQIVQTQVQQARNQAHIAEVQLAASQTDEIkrtITE--DKGNPPSGgs 225 tropical clawed...
XP_005989033 159 SNWVSAVNLSQVAAEAAYQAGADQASVTVHTCVQLAQKQVADMQQLALNAESKLAEVQVEEIr-kTSERERTASKNTGtr 237 coelacanth
NP_001229963 151 SCWMTAVNLSQQAAEAAFNAGADQASVAAQSSLQVAQSQVEQVKQLMLEAEIQLKDSKAEYSe-rLQ------------- 216 zebrafish
NP_956640    178 SNWMNAINICELSAEAAYNSGAEHACTATKTNLQVAQSKVEEIRKISKEAEKKLAETKAEEIq-rMAEYASS-------- 248 zebrafish
XP_003968615 150 STWGSAVKLCETAAEAAYASGAEHASISVRTNMQVAQAQVDEARKLSAEAERKLAEAKVMEVe-rMSQRVTS-------- 220 torafugu
XP_015197532 147 SNWMNAINLSELAAEAAYNAGADQASVTARTNLNMAQTQVEEMKRLSSEAEKQLAEVKVEEIq-rTAAQAAA-------- 217 spotted gar
XP_008118066 151 SRWMTALRLSEMAAEAAYQSGADQASVGTHNHIQLVRTQIQEARQLSQKAESKLAEVQTEELmklKEEEALAAARRQAsv 230 green anole
XP_003761096 151 TTWMTALSLSEMAAEAAYQSGADQASIMARNHVQLVKTQVQEVRQLSQTAETKLAEAQTEELrlrRPEELEKGTMPQRps 230 Tasmanian devil
XP_027325975 226 --VIGstd----------ageDPYLRED 241 mallard
NP_001232563 225 gnADD----------------DPYLRED 236 zebra finch
Q5RBH2       233 ---------------------EAYLRED 239 Sumatran orangutan
XP_008248773 265 --------------------qEAYLRED 272 rabbit
Q0IJ31       226 prSSLseee---------eipEAYLRED 244 tropical clawed frog
XP_005989033 238 kkTEAeete--------ddipEQYLRED 257 coelacanth
NP_001229963 217 --VALsede---------dipDAYLRED 233 zebrafish
NP_956640    249 --IDIhdle---------dvpEAYLRED 265 zebrafish
XP_003968615 221 --MENneee---------evpDAYLRED 237 torafugu
XP_015197532 218 --TRAfekagkgdalseddvpEAYLRED 243 spotted gar
XP_008118066 231 eeAE-----------------EAYLRED 241 green anole
XP_003761096 231 tgGSLmtd----------heeEAYLRED 248 Tasmanian devil
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap