6JHO


Conserved Protein Domain Family
CagZ

?
pfam09053: CagZ 
CagZ
CagZ is a 23 kDa protein consisting of a single compact L-shaped domain, composed of seven alpha-helices that run antiparallel to each other. 70% of the residues are in alpha-helix conformation and no beta-sheet is present. CagZ is essential for the translocation of the pathogenic protein CagA into host cells.
Statistics
?
PSSM-Id: 401116
View PSSM: pfam09053
Aligned: 3 rows
Threshold Bit Score: 390.21
Threshold Setting Gi: 81341308
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6JHO_A  11 ELGFNEAERQKILDSNSSLMGNANEVRDKFIQNYASSLKDSNDPQDFLRRVQELRINMQKNFISFDVYYNYLNNLVLASY 90 
O25261   2 ELGFNEAERQKILDSNSSLMGNANEVRDKFIQNYASSLKDSNDPQDFLRRVQELRINMQKNFISFDVYYNYLNNLVLASY 81  Helicobacter pylori
O25261   2 ELGFNEAERQKILDSNSSLMGNANEVRDKFIQNYASSLKDSNDPQDFLRRVQELRINMQKNFISFDVYYNYLNNLVLASY 81  Helicobacter pylori
6JHO_A  91 NRCKQEKTFAESTIKNELTLGEFVAEISDNFNNFMCDEVARISDLVASYLPREYLPPFIDGNMMGVAFQILGIDDFGRKL 170
O25261  82 NRCKQEKTFAESTIKNELTLGEFVAEISDNFNNFMCDEVARISDLVASYLPREYLPPFIDGNMMGVAFQILGIDDFGRKL 161 Helicobacter pylori
O25261  82 NRCKQEKTFAESTIKNELTLGEFVAEISDNFNNFMCDEVARISDLVASYLPREYLPPFIDGNMMGVAFQILGIDDFGRKL 161 Helicobacter pylori
6JHO_A 171 NEIVQDIGTKYIILSKNKTYLTSLERAKLITQLKLNLE 208
O25261 162 NEIVQDIGTKYIILSKNKTYLTSLERAKLITQLKLNLE 199 Helicobacter pylori
O25261 162 NEIVQDIGTKYIILSKNKTYLTSLERAKLITQLKLNLE 199 Helicobacter pylori
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap