Conserved Protein Domain Family
Titin_Z

?
pfam09042: Titin_Z 
Titin Z
The titin Z domain, that recognizes and binds to the C-terminal calmodulin-like domain of alpha-actinin-2 (Act-EF34), adopts a helical structure, and binds in a groove formed by the two planes between the helix pairs of Act-EF34. This interaction is essential for sarcomere assembly.
Statistics
?
PSSM-Id: 401109
View PSSM: pfam09042
Aligned: 17 rows
Threshold Bit Score: 32.0531
Threshold Setting Gi: 2308982
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_028928092   556 MTRETKKTV-VPKVIIATPKVKEQDTVSRTREGFMTSQEQ 594   platypus
XP_019472906   401 EVRRDSEKTaAVATVVAAVDQAMVREPAPSVVEQAAKRTA 440   turkey
XP_023398816   555 TIKQEAETT-AAAMVVVAVAKPKQLETVLGAQEEISIKQE 593   African savanna elephant
XP_017456475   555 TLRQETETI-AAS-VVVATAKSTKLEAAVGIQEETAIQQD 592   Norway rat
EGW08606      1963 TVRQEAEKI-AASMVVLATAKSTKLETAMGVQEEIAIQQD 2001  Chinese hamster
BAA21716        51 QIRREDVKP-SVPKVVITTDKPKAPVLISKSKEGIATKKE 89    chicken
XP_023355088   513 KIRKETEKA-FVPKVVITAAKAKEQET--KTAEGIMtrqq 549   Tasmanian devil
XP_028928092   509 KVRKETEKA-FVPKVIISAAKAKEQETVSKITEGKATKQE 547   platypus
XP_027721500   647 KIRKEAEKL-AHSTIAAAAAKAKVQETTLRSREGMAIRHE 685   common wombat
XP_028928092   412 QVIQDSDKTaAVATVVAAVDLARVREPVTSAVEETAMRTt 451   platypus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap