6BJC


Conserved Protein Domain Family
Aurora-A_bind

?
pfam09041: Aurora-A_bind 
Click on image for an interactive view with Cn3D
Aurora-A binding
The Aurora-A binding domain binds to two distinct sites on the Aurora kinase: the upstream residues bind at the N-terminal lobe, whilst the downstream residues bind in an alpha-helical conformation between the N- and C-terminal lobes. The two Aurora-A binding motifs are connected by a flexible linker that is variable in length and sequence across species. Binding of the domain results strong activation of Aurora-A and protection from deactivating dephosphorylation by phosphatase PP1.
Statistics
?
PSSM-Id: 370257
View PSSM: pfam09041
Aligned: 13 rows
Threshold Bit Score: 106.434
Threshold Setting Gi: 1020964988
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6BJC_P         1 MSQVkSSYSYDAPSDFINFSSLDDEGDTQNIDSWFEEKANLENKLLGKNGTGGLFQGKTPLRKANLQQ 68 
XP_010589897   1 MSQV-TSYSFDAPTDYINFTSLNDEENNENVDSWFEEKANLENMFPGKNGTGGPFQGKTPLRKGNRQQ 67  African savanna elephant
A2APB8         1 MSQVpTTYSFDAPTDFINFSSLDAEEDTENIDSWFDEKANLENKFLRQRGIGEPFQGKNSLRKAKLQQ 68  house mouse
XP_013015445   1 MSQVkNSYSFDAPSNFINFTSLDYDEDTENIDSWFEEKANLENKFFGKNGTGELFQSKTSLKKANLQQ 68  domestic guinea pig
XP_013211954   1 MSQVtTTYSFDAPTDFINFTSLDDEEDSENIDSWFDEKANLENKYPG-NGTGELFQSKTSVKKGNLQQ 67  thirteen-lined ground squirrel
XP_012310647   1 MSQVrHSYSYDAPSDFINFSSL-DDGDTQNVDSWFEEKANLENKLLGKNGTGGLFQGKTPLRKTNLQQ 67  Ma's night monkey
XP_012659634   1 MSQVqTSYSYDVPKDFIDFTSLDDEGDTENIDSWFEEKANLENKLLGKNGTGGPFQSKTPLRKSNLQQ 68  small-eared galago
XP_012044402   1 MSQVtTSYSYDAPTDFINFSSLTDEEDTQHIDSWFDEKANLENKFPGKDGTGGLFQGKTPLRKANLHQ 68  sheep
XP_007474524   1 MSQSrASYSFDAPTAFINFTSFNNE-DVCNVDSWFEERANLENKPPEDDEVPGPSYRKTPLRKTHvpq 67  gray short-tailed opossum
XP_016158800   1 MSKPeSRYSFDVPNICIDFATLNED-DVHNADSWFDQKANLENVPPAENLVSPC---SPAFSKPDvil 64  Collared flycatcher
XP_002710892   1 MSQVqSSYTFDAPTDFINFTSLNDEEDSENVDLWFEEKANLENKFPGKNGTGELLHGKTTLRKANLQQ 68  rabbit
XP_019477893   1 MSRSeSRYSFDVPNPCINFATLSDD-DVHNADSWFDQQANLENIPPAEN-LAKVLQNSPAFSKPlils 66  turkey
XP_025841905   1 MSQVkTSYSYDAPTDFINFTSLDDEEDAQNIDSWFEEKANLENKFSGKNGIAGLFQDKTPLRKPNPQQ 68  red fox
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap