4FCY


Conserved Protein Domain Family
HTH_Tnp_Mu_2

?
pfam09039: HTH_Tnp_Mu_2 
Mu DNA binding, I gamma subdomain
Members of this family are responsible for binding the DNA attachment sites at each end of the Mu genome. They adopt a secondary structure comprising a four helix bundle tightly packed around a hydrophobic core consisting of aliphatic and aromatic amino acid residues. Helices 1 and 2 are oriented antiparallel to each other. Helix 3 crosses helices 1 and 2 at angles of 60 and 120 degrees, respectively. Excluding the C-terminal helix 4, the fold of the I-gamma subdomain is remarkably similar to that of the homeodomain family of helix-turn-helix DNA-binding proteins, although their amino acid sequences are completely unrelated.
Statistics
?
PSSM-Id: 370256
View PSSM: pfam09039
Aligned: 6 rows
Threshold Bit Score: 107.757
Threshold Setting Gi: 1175816
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4FCY_A         73 YYQVQKFAKPDWAAALVDGR---GASRRNVHkseFDEDAWQFLIADYLRPEKPAFRKCYERLELAAREHGW-SIPSRATA 148
jgi:Xaut_4525 161 SHLVGGLDRADWLPALAPRH---IGRVAEAE---IPAEMWATFVSDYLRDSKPTIAACFRRTESAAQAAGL-AIPSMKTF 233 Xanthobacter a...
O05069        160 WYRVKDAPRQDWLPLMLN-----NSGKSSKNvaeIDEAAWQFFKNFYYSREKPSLAHSYEVLKQAAQYNGW-RIPSRSSL 233 Haemophilus in...
P07636        149 YYQVQKFAKPDWAAALVDGR---GASRRNVHkseFDEDAWQFLIADYLRPEKPAFRKCYERLELAAREHGW-SIPSRATA 224 Escherichia vi...
P44208          1 MSNIT-----------------------------LNENAMLYLKADYYRPEMPTFKACYFRLSKIAQEQGWgTLPNLAQT 51  Haemophilus in...
Q8EDT9        147 CAMVKGIDEADWAPALLPKHfevAQAKKKNQfafITPEAWEAFKTDYLRFEQPTMTVCYERLKEIAKDKGW-AIPSLKSL 225 Shewanella one...
4FCY_A        149 FRRI-QQLDEAMVVACREGEHALMHLIPAQQRT 180
jgi:Xaut_4525 234 QRRV-EAMPKTTVVLAREGVDGLKKLYPAQERD 265 Xanthobacter autotrophicus Py2
O05069        234 KRKMeRDVPKTEEVFRREGQYALSRLYPSQVRT 266 Haemophilus influenzae Rd KW20
P07636        225 FRRI-QQLDEAMVVACREGEHALMHLIPAQQRT 256 Escherichia virus Mu
P44208         52 KALFkAAVPE--IIWTREA----FKRANTQKKH 78  Haemophilus influenzae Rd KW20
Q8EDT9        226 SRRMdFEVPAQQLVLLRQGEHALHQLYPPQERS 258 Shewanella oneidensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap