4RG2


Conserved Protein Domain Family
53-BP1_Tudor

?
pfam09038: 53-BP1_Tudor 
Click on image for an interactive view with Cn3D
tumor suppressor p53-binding protein-1 Tudor
Members of this family consist of ten beta-strands and a carboxy-terminal alpha-helix. The amino-terminal five beta-strands and the C-terminal five beta-strands adopt folds that are identical to each other. This domain is essential for the recruitment of proteins to double stranded breaks in DNA, which is mediated by interaction with methylated Lys 79 of histone H3.
Statistics
?
PSSM-Id: 401108
View PSSM: pfam09038
Aligned: 2 rows
Threshold Bit Score: 259.167
Threshold Setting Gi: 697351488
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4RG2_A          2 GNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHR 81   human
XP_011608125 1123 GSSFVGLRVVAKWSSNGYFYSGRIMKDAGEGRFRLRFDDGYECEVAGKDILLCDPIPLETEVTALLEDEYFSIGVVRGHK 1202 torafugu
4RG2_A         82 KESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLGP 123  human
XP_011608125 1203 TEGQELFYSVEKDGQRQWYNRKAVILSLEQGNKLREQHSLGP 1244 torafugu
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap