1Y4H,1Y4H


Conserved Protein Domain Family
Staphostatin_B

?
pfam09023: Staphostatin_B 
Click on image for an interactive view with Cn3D
Staphostatin B
Staphostatin B inhibits the cysteine protease Staphopain B, produced by Staphylococcus aureus, by blocking the active site of the enzyme. The domain adopts an eight-stranded mixed beta-barrel structure, with a deviation from the up-down topology of canonical beta-barrels in the amino-terminal part of the molecule.
Statistics
?
PSSM-Id: 401098
View PSSM: pfam09023
Aligned: 2 rows
Threshold Bit Score: 195.7
Threshold Setting Gi: 60594114
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1Y4H_D   3 QLQFINLVYDTTKLTHLEQTNINLFIGNWSNHQLQKSICIRHGDDTSHNQYHILFIDTAHQRIKFSSFDNEEIIYILDYD 82  Staphylococcus aureus
1Y4H_D   3 QLQFINLVYDTTKLTHLEQTNINLFIGNWSNHQLQKSICIRHGDDTSHNQYHILFIDTAHQRIKFSSFDNEEIIYILDYD 82  Staphylococcus aureus
1Y4H_D  83 DTQHILMQTSSKQGIGTSRPIVYER 107 Staphylococcus aureus
1Y4H_D  83 DTQHILMQTSSKQGIGTSRPIVYER 107 Staphylococcus aureus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap