1FIU


Conserved Protein Domain Family
NgoMIV_restric

?
pfam09015: NgoMIV_restric 
NgoMIV restriction enzyme
Members of this family are prokaryotic DNA restriction enzymes, exhibiting an alpha/beta structure, with a central region comprising a mixed six-stranded beta-sheet with alpha-helices on each side. A long 'arm' protrudes out of the core of the domain between strands beta2 and beta3 and is mainly involved in the tetramerisation interface of the protein. These restriction enzymes recognize the double-stranded sequence GCCGGC and cleave after G-1.
Statistics
?
PSSM-Id: 401095
View PSSM: pfam09015
Aligned: 6 rows
Threshold Bit Score: 450.406
Threshold Setting Gi: 123650215
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1FIU_A        12 FHKKLLDGnILATNNRG---VVSN-ADGSNTRSFNIAKGIADLL-----HSETVSERLPGQTSGNAFEAICSEFVQSAFE 82 
jgi:Ajs_4253  14 FHASLLQT-TLTINSAG---VVSN-ADSSNTTSKAIAKGIADLL-----KAETIGERIAGQTSGNQFEGTCAAFVRETFL 83  Acidovorax sp. ...
Q5F8B2        12 FHKKLLDGnILATNNRG---VVSN-ADGSNTRSFNIAKGIADLL-----HSETVSERLPGQTSGNAFEAICSEFVQSAFE 82  Neisseria gonor...
WP_013561259  10 YHQRICREiVRIQQGES---AYPNfADKSSKASREIAWRILEKIg----YQTSQEQSLPGQTAGGRFEDVTRDFLEKAFQ 82  Anaerolinea the...
Q4JT21        15 LHRELIDEgVLTIADAAkgrIASN-ADSSSNASRETALHLADQL------GASVARKKAGQSMGADFERAVAKFIKKTFT 87  Corynebacterium...
CDD27324      12 FHKQLFETnTLTLTSAG---VASN-ADTSSRGSKAIARRIVDILvdeqhHAVSTVDKISGQTLGKQFETLTMDFLRETFP 87  Firmicutes bact...
1FIU_A        83 KLQHIRPGDWNVKQVG-SRNRLEIARYQQYAHLTALAKAAEENPELAAALGSDYTITPDIIVTRNLIADAEINRNEFLV- 160
jgi:Ajs_4253  84 KLGHLRPGTWDVHQVS-GRNRLEIARYEQYAHLVALDRAAKADAELAAALGSDYTITPDIVVVRDTEDDSAINAPAFLV- 161 Acidovorax sp. ...
Q5F8B2        83 KLQHIRPGDWNVKQVG-SRNRLEIARYQQYAHLTALAKAAEENPELAAALGSDYTITPDIIVTRNLIADAEINRNEFLV- 160 Neisseria gonor...
WP_013561259  83 ELQHIRPGKWLY------KTGMNISLFDQYEHLARLQKLTIKNSDLSSIFGTEYLITPDITVSREPLNDEEINRSMTIVe 156 Anaerolinea the...
Q4JT21        88 HMQSVRPGTWEVQNVGsSRRREHLFLCEPYSHLADLAELVRRYPELGAALGNSYSISPDILVLREPVTDDEFNEGEFLV- 166 Corynebacterium...
CDD27324      88 NLQNLRPGRWTILQLG-NNNKLKTSDFAQYEHLAYLNELTAQNAQLAAALGNDYLVAPDVVIYRDLYEDSEINAAQCIV- 165 Firmicutes bact...
1FIU_A       161 DENIATYASLRAGNGNMP--LLHASISCKWTIRSDRAQNARSEGLNLVRNRKGRLPHIVVVTAEPTPSRISSIALGTGEI 238
jgi:Ajs_4253 162 DDNVTTLASLRKKNGGLP--LLHASISCKWTIRSDRAQNARSEALNLVRNRKGRLPHVVVVTAEPTPSRLASIALGTGDI 239 Acidovorax sp. ...
Q5F8B2       161 DENIATYASLRAGNGNMP--LLHASISCKWTIRSDRAQNARSEGLNLVRNRKGRLPHIVVVTAEPTPSRISSIALGTGEI 238 Neisseria gonor...
WP_013561259 157 DSRLAGLTPLRKTNSSVP--ILHASISCKWTLRSDRSQNARAEALNLIRQRKGNTPHIVVVVAEPLPTRIASLALGTGDI 234 Anaerolinea the...
Q4JT21       167 DGNSGLGSPVRASNRENPakIVHAVVSCKWTMRSDRAQNTRAEALNLIEHRKARAPHIVAVTGEPLVTRIASLALGTGDI 246 Corynebacterium...
CDD27324     166 DGDVSKMADIRKANGGKP--LLHASVSAKYTMRSDRAQNSRTEALNLIRNRKGHLPHIVVVTAEPMPNRLASLALGTGDI 243 Firmicutes bact...
1FIU_A       239 DCVYHFALYELEQILQSLNYEDALDLFYIMVNGKRLKDISDLPLDLAV 286
jgi:Ajs_4253 240 DCVYHFALYELQATVEALGMTDAADMLAVMVDGKRLKDISDLPLDLAV 287 Acidovorax sp. JS42
Q5F8B2       239 DCVYHFALYELEQILQSLNYEDALDLFYIMVNGIRLKDISDLPLDLAF 286 Neisseria gonorrhoeae FA 1090
WP_013561259 235 DCVYHFALPELQQAILEIHNEDQHDMLQTLIEGRRLRDISDLPFDLAI 282 Anaerolinea thermophila
Q4JT21       247 DMTYHFALPELKKAVEAVGNDDTCELLHTLIAGDRLRDISDLPLDMSV 294 Corynebacterium jeikeium K411
CDD27324     244 DCVYHFALYELIRAVKEVGSEDAVETLETLVQGKRLKDISDLPLDLAV 291 Firmicutes bacterium CAG:94
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap