2APL


Conserved Protein Domain Family
DUF1896

?
pfam08989: DUF1896 
Click on image for an interactive view with Cn3D
Domain of unknown function (DUF1896)
This domain is found in a set of hypothetical bacterial proteins.
Statistics
?
PSSM-Id: 401076
View PSSM: pfam08989
Aligned: 14 rows
Threshold Bit Score: 178.267
Threshold Setting Gi: 511625373
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2APL_A                   4 TEKKELSHFRLKLETYLNEHFPEXSGNNPFITARSDEALTAYCDAVAQGFSHPEAESXASEVLYQGLHFSRYDTLVSVLE 83  Porph...
Q8A5B4                  14 EEPDELSYYRLTLLSFLRESHPDLADDESFVATRSEQAAEAFSAAVRSGLTYDDAAQQANALLFQGLHFSPLDTLVTVLW 93  Bacte...
jgi:Lbys_0180            3 TQQKDLSYFRLRLQELLHTSFPEKAYDNKFIEQRSSWAANAYEGAFRSGNSIDQCDEIANYILFEGLHFSRFDTVFQVVC 82  Leadb...
WP_014791708             3 TQEKEISYYDLRLRELLNTSFPNLATNEAFIKERSDLAAEAYERAFDAGHSVLECRAIANEALFEGLYYSPFDTVYQVVC 82  Ornit...
WP_006948486             4 NNKQELSYFRLKLRSYMSEHHPERLHDTEFITTRADMALTAYCDAVAQGFSHPEAESIASEVLYQGLHFSKYDTLVSVLE 83  Prevo...
Q7MUP8                   3 QEKRTLSYYRLRLEVYLKDYHPQLLGDETFIRERSEAAAKTYEEAFLQDNPIGIAESMAMEVLLRGLHFSPYQFIKQIID 82  Porph...
wustl:BV2055             8 TATGELSYFETTLLLYLKESHPHIAGDKELVRTRTDEAAAGYERAIRDGLSVMQALQLVEAVLYQDLRFSRFDTVFEVVS 87  Bacte...
Q89YI1                   7 DNNGELSYFKSALLFYLKESHPHMAGNKVLIQKRANSAAEAYEHAVRGGLPVAQALEAADAFLQHGLKFSKYDTVFEMVS 86  Bacte...
CCY16457                 6 KKRKELSYYHLYLQKHLQENRFEQADDASFIETRADLAATAYEQARREGYPIEGAQELAMQTLLKGLHHSKYAILREVIT 85  Prevo...
PRJNA51771:BARVI_12440   8 EGQTDFSYYGLYLLDYLRTNKFEQADDTAFIRERADRAAETYERARLEGYPADGAQELAMDTLLRGLHYSRYAILREVVE 87  Barne...
2APL_A                  84 REFEQELPSPLPERLAPILLKNkaIQSVFAKYDLTDD-FEASPEYEHLYTELTGTIVLLIESNHL 147 Porphyromonas gingiv...
Q8A5B4                  94 NEFAAEVPEGSARSVALQLLPE--CRKVFAGYTLSDD-FMFSPEFGQLYDELTGTVVIWLEENGL 155 Bacteroides thetaiot...
jgi:Lbys_0180           83 NEFDTIMADEELRPFALKMLPV--CGPVFEGYVLTDN-FAYSTAYDLLYTELTGTIAIWIEENGL 144 Leadbetterella bysso...
WP_014791708            83 NEFDREIPADEARAFALKMFPY--CIEVFEHYNLHQD-FEGSQAYDALYTELTGQIQIWIEENGV 144 Ornithobacterium rhi...
WP_006948486            84 NEFERELPAPLPEKLAPILLSNkaVQATFDKFGLTDT-FAASGQYDRLYTELTGTIVLLIESNNL 147 Prevotella
Q7MUP8                  83 NEFANEVPAELSGKLSLLLLEHkeVKDTFDRYHPGDD-FDEKPEYDRLYTELTGTIATVMEEHDL 146 Porphyromonas gingiv...
wustl:BV2055            88 EWF-PEVRPEKRTGFCLKVLPP--AEAVFNKYPIDDR-FESSPSYHTLTIELTGFIQSYIEKYGI 148 Bacteroides vulgatus...
Q89YI1                  87 EWF-PEIPSERRKDFCLKILPL--AEAVFKKYPIDDR-FETSPSYRTLTIELTGFIQSNIEKYGI 147 Bacteroides thetaiot...
CCY16457                86 NEFAYEIPETQQEALSKKLLPL--VDSVFSIYDLSDDhFAQSLDYDLLYSELTGAVVLYLAEYGV 148 Prevotella sp. CAG:755
PRJNA51771:BARVI_12440  88 NEFADEVPEEKREAFVLKLLPL--VGNVFSVYDLSDDnFALSSDYDLLYTELTGATVLYLDEYGV 150 Barnesiella visceric...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap