Conserved Protein Domain Family
DUF1889

?
pfam08986: DUF1889 
Domain of unknown function (DUF1889)
This domain is found in a set of hypothetical bacterial proteins.
Statistics
?
PSSM-Id: 401074
View PSSM: pfam08986
Aligned: 2 rows
Threshold Bit Score: 226.577
Threshold Setting Gi: 218365441
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
nankaitd:CDCO157_2353   1 MQIKVIYSLIDNMVNFKDKNMPAVIDKALDFIGAMDVSAPTPSSMNESTAKGIFKYLKELGVPASAADITARADQEGWNP 80  Escher...
CAR03168                1 MQIKVIYSLIDNMVNFKDKNMPAVIDKALDFIGAMDVSAPTPSSMNESTAKGIFKYLKELGVPASAADITTRADLEGWNP 80  Escher...
nankaitd:CDCO157_2353  81 GFTEKMVGWAKKMETGERSVIKNPEYFSTYMQEELKALV 119 Escherichia coli Xuzhou21
CAR03168               81 GFTEKMVGWAKKMESGERIVIKNPEYFSTYMQEELKALV 119 Escherichia coli S88
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap