1SED


Conserved Protein Domain Family
DUF1878

?
pfam08963: DUF1878 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF1878)
This domain is found in a set of hypothetical bacterial proteins.
Statistics
?
PSSM-Id: 401059
View PSSM: pfam08963
Aligned: 10 rows
Threshold Bit Score: 141.337
Threshold Setting Gi: 81435622
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1SED_B                   3 MdSMDHRIERLEYYIQLLVKTVDMDRYPFYALLIDKGLSKEEGEAVMRICDELSEELATQKAQGFVTFDKLLALFAGQLN 82  Bacil...
WP_012009451             1 M-SIEERMSQLEYYMELLLTATDMSRYPYYALLMRQQVSKEEAQEIERICAELSEEMDKQKAQGYVMFDDMLALFAGQLI 79  Bacil...
Q65LS9                   1 MnSMEQRLERLEYYIKLLLNNADMEEYPYYKILIEKGLSEEEAKETEKLCEELSKELEAQKAQGFVMFDHLLTLFAGQLN 80  Bacil...
Q81GY2                   1 Md-VVRRLEQAEYYVDLLFKMIDEEKCPFYSLIIKKKARKKDIERILNLCEKLNDQYVVEKAEGLLLFDALLDQFEKALP 79  Bacil...
WP_014095795             1 MeSIEQKLERLEFYQTLLLKMIGTSQYPFFRLIMEKQLSKQDIEQFYALCDRLSDELKEQKADKFVYFYPLFQKFKESLH 80  Bacil...
PRJNA212797:N288_06825   3 igeLLERIEKLEYHQKLLLMMASGQTLPFYRMVVEKSLDQKEVTQFFYLCDKLSKELEEQKAEGFVYFHPLYTEFKHKLH 82  Bacil...
WP_015592610             3 ynaLIDKIVQLEYHQKLLLKMLSDTKLQFFKLVIEKSLREADVDAFFKLCDQLSNDLKEQKAEGFVHFNPLFDKFKVNLH 82  Bacil...
WP_012575821             1 M-SIEQRIEKLEYYCSLMLDMIAPEKKPFYALVIRYGLEKEEVESILRLCEQLSEQYKQQKEEGFVIFTSLFTQFANALH 79  Anoxy...
Q5L292                   1 MeSLEKRVAKLEFHQSLLMEMIDETKKPFYSLIIRADLTKEEVDAFLAFCQELADQYEQQKAEGLTIFTPLLVQFAGMLH 80  Geoba...
jgi:GWCH70_0641          1 MgTLEERIAKLEFHRSLLMEMVDETKKPFYYLVIKANLTKEEVDEVLALCEQLSEEYEKQKAEGLTIFTPLLLHFAGMLH 80  Geoba...
1SED_B                  83 EKLDVHETIFALYEQGLYQELMEVFIDIMK 112 Bacillus subtilis
WP_012009451            80 EKLDVHETIFALHDQGLFQPLMNEFIKIIK 109 Bacillus pumilus
Q65LS9                  81 EKLEVHETIFALHRQGLYKPLMSEFISIIR 110 Bacillus licheniformis DSM 13 = ATCC 14580
Q81GY2                  80 HQLEVHETAEALAKQGLFKPLMNEFLSMIA 109 Bacillus cereus ATCC 14579
WP_014095795            81 EKLQPAEVIAACLQQGLYPDLMKALKrnl- 109 Bacillus coagulans
PRJNA212797:N288_06825  83 PSLKPEMVIPACLRQNLFMDLMSELKKyl- 111 Bacillus infantis NRRL B-14911
WP_015592610            83 PNLQAEDVIRSCLAQQLFTPLMTEFKKYI- 111 Bacillus sp. 1NLA3E
WP_012575821            80 PNLPLAETIDALKQQQLFVPLMTEFQRLLH 109 Anoxybacillus flavithermus
Q5L292                  81 PNLPLEQTVDALLAQQMFVPLMTELKTLIR 110 Geobacillus kaustophilus
jgi:GWCH70_0641         81 PSLPLEQTVDALLKQQMFVPLMTELKKLMK 110 Geobacillus sp. WCH70
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap