1U84


Conserved Protein Domain Family
DUF1871

?
pfam08958: DUF1871 
Click on image for an interactive view with Cn3D
Domain of unknown function (DUF1871)
This set of hypothetical proteins is produced by prokaryotes pertaining to the Bacillus genus.
Statistics
?
PSSM-Id: 401055
View PSSM: pfam08958
Aligned: 7 rows
Threshold Bit Score: 131.748
Threshold Setting Gi: 75492458
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1U84_A       12 LLLEWIGAWDPFGLGKDAYDVEAASVLQAVYETEDARTLAARIQSIYEFAFDEPIPFPHCLKLARRLLELKQAASCP 88  Geobacillus stearot...
WP_012011085  9 EMIQLIKAWDPFQYGEDFYETEPADVISALYDAEDPLSLAKDIQAIYHHSFEQLLPLESCQHIANQLFVIRDSSSCT 85  Bacillus pumilus
O05234        9 EMIKIIAKWDPFKYGEEFYETEAVDVVQAVYDENDPDLLAKSIQQIFETSFEQTLPIASCREVAGQLLFIKNSSSCT 85  Bacillus subtilis s...
Q62R20       12 QIIHIIKEWDPFQAGPDFYETEAAEIVQAVYTEDDAERLGEAIQTVFEVSFDQTLPLSECKRLAERLLVIKDSSSC- 87  Bacillus lichenifor...
WP_009795411  9 MMYQALDQWDPFRCGEGNYDTEIADAIHAVHDLDSPDKLARKIQGIYEFSFESIIPLEQCKKMAETLLVIKNSGSCT 85  Bacillus
BAK15505     12 KCVHLLEQWDPFSYGTDSYSTETADVVAALQNIDDPTTLAKVIQRVYEYSFEQWIPFEQCVAIAYKLIAVKFEAKCI 88  Solibacillus silves...
Q816F4        6 KMIEVVKNWDPFQMGPEFYETEASDVVNVISVFDDPKYIAKKIQHIYFMSFEEVPALEKCEKLAVELLVIKEGGSCS 82  Bacillus cereus ATC...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap