1NEI


Conserved Protein Domain Family
DUF1869

?
pfam08956: DUF1869 
Click on image for an interactive view with Cn3D
Domain of unknown function (DUF1869)
This domain is found in a set of hypothetical bacterial proteins.
Statistics
?
PSSM-Id: 401054
View PSSM: pfam08956
Aligned: 7 rows
Threshold Bit Score: 85.6333
Threshold Setting Gi: 48425072
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1NEI_A                5 TYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW 60  Escherichia coli
wugsc:KPN_02453      28 EFLLTVTNNNNGVSVDKTFSSLAALRDPLTAADTVKDLINIVRGYESDEETNVCGW 83  Klebsiella pneumoniae subsp. pne...
goetting:EBL_c27970  57 EMMMTVTNKNNGVSVDKEFSRLSLLRDPVTAADGVKDLINIVRGYESEEDANVCGW 112 Shimwellia blattae DSM 4481 = NB...
Q6D753               29 GFLLTVTNNNNGVSVDKDFSALAELKDKTISAESVKELVNIVRGYDADEETNVCGW 84  Pectobacterium atrosepticum
IEC:ABF-0015780      71 DFLLTVTNKNNGVSVDKDFATLSELQDPAIAADAVKELINIVRGYESDEETNVCGW 126 Dickeya dadantii 3937
CAR41821             58 aLTLTLTNKNNGVSVDKECE-IKDLLDPDMASLMVKDLINIVRGYDMDEEANVCGW 112 Proteus mirabilis HI4320
WP_004235890         58 ALMVTMTNKNNGVSVDKDVDSAAELADAENAAQIVKDLINIIRGYDMDEETNICGW 113 Morganella
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap