2B4E


Conserved Protein Domain Family
DUF1899

?
pfam08953: DUF1899 
Click on image for an interactive view with Cn3D
Domain of unknown function (DUF1899)
This set of domains is found in various eukaryotic proteins. Function is unknown.
Statistics
?
PSSM-Id: 401051
View PSSM: pfam08953
Aligned: 106 rows
Threshold Bit Score: 56.3545
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2B4E_A          4 QVVRSSKFRHVFGQPAKADQCYEDVRVSQT--TWDSGFCAVNPKFMALICEASGGGAFLVLPLGKTGR 69   house mouse
EGG14736       32 KLPTASRFKYTNGTPNQPADTIFGCSVGTT--SQDSNVLQANHSFIAFPAKVS--GSVCVIPLNSKGT 95   Cavenderia fasciculata
EFN83440      735 VFGRVSKFRHLKGTPGHKSTHIENIRNISRqiSGECDGFHANPDRVAVPLSGPG-GKIAVLELKKTGR 801  Jerdon's jumping ant
XP_022520803  459 mlgPSSKFRHIQGSVLHRDTHITNLRGMSLttPGECDGFCANGKRVAVPLATAG-GQIAVLELSQPGK 525  Mexican tetra
Q55E54        486 KVVRSSKYRHISGSAHQKSQFYTNLKINGS---TSNTCIAVNSEYVAVPMVGIG-GPLAVIPLADKGR 549  Dictyostelium discoideum
Q5CXY9          3 RIVHDSKFRNLYGECMQDRFSGLHIVTSRH--TVDGCGIAASTEFIAFPAECSGGGSVGVIDNSSFGY 68   Cryptosporidium parvum
XP_004362280  474 KVVRTSKYRHIAGTAFPRSQQYTNLKVSGN---TSNTCIASNSLYFAVPFVGTG-GPLAVIPISQVGR 537  Cavenderia fasciculata
XP_020433308  460 KIVRTSKYRHINVAPFPKTSHYTNLKVFGN---TSNTSIAVNSEYVAVPWVGTG-GPLAVIPLSQVGR 523  Heterostelium album PN500
XP_001641819  470 SGVRSSKFRHIIGVPMHKSTNIENIRNLSMstFGECDGLQLNKEFVAYPLSGPG-GQIAVLPHNKPCR 536  starlet sea anemone
XP_004343183  469 AIVRSSKYRHVQGTLLHKKNNIESISQLSPvtPIESNMFDANKSFMCMPFSGPG-GQLAVFPTMVARR 535  Capsaspora owczarzaki ATC...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap