1W8X


Conserved Protein Domain Family
DUF1859

?
pfam08948: DUF1859 
Click on image for an interactive view with Cn3D
Domain of unknown function (DUF1859)
This domain has no known function. It is predominantly found in the N-terminus of bacteriophage spike proteins.
Statistics
?
PSSM-Id: 401047
View PSSM: pfam08948
Aligned: 2 rows
Threshold Bit Score: 195.973
Threshold Setting Gi: 116657
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1W8X_N   1 MNVNNPNQMTVTpvYNGCDSGEGPQSVRGYFDaVAGENVKYDLTYLADTQGFTGVQCIYIDNAENDGAFEIDVEETGQRI 80  Enterobacteria phage ...
P22536   1 MANQQIGGSTVT--YNGAIPMGGPVAINSVIE-IAGTEVLVDLKLDYATGKISGVQTLYIDLRDFLGDVTVTMPDTGQRI 77  Enterobacteria phage ...
1W8X_N  81 KCPAGKQGYFPLLVPGRAKFVARHLGSGKksVPLFFLNFTIAQGVW 126 Enterobacteria phage PRD1
P22536  78 TARAGTQGYYPVLSTNLMKFIVSATIDGK--FPMNFINFPIALGVW 121 Enterobacteria phage PRD1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap